KEGG   Edwardsiella piscicida C07-087: ETAC_12470Help
Entry
ETAC_12470        CDS       T02509                                 

Definition
(GenBank) EdwI
  KO
K22956  acyl homoserine lactone synthase [EC:2.3.1.184]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00270  Cysteine and methionine metabolism
etc01100  Metabolic pathways
etc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ETAC_12470
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_12470
Enzymes [BR:etc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.184  acyl-homoserine-lactone synthase
     ETAC_12470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Autoind_synth Acetyltransf_5 A2L_zn_ribbon
Motif
Other DBs
NCBI-ProteinID: AGH74615
Position
complement(2807906..2808568)
Genome map
AA seq 220 aa AA seqDB search
MFEIFDVDYQSLSRTTSTELFSLRKGTFKDRLNWAVTCSDGMEFDEYDSEHTTYLLGVKD
NDVVCSVRLIETCHHNMIVGTFFRYFEKGEIPASSQFFESSRFFVDKRRARTLLGNQYPL
CHLLFLAMINYTMASGHRGIYTIVSHSMLRILTRSGWNITVVERGVSEKAQDIYLVYLPT
DAANQRLLIERINQDQPFDEEALQSWPLVLKADTLSPQSA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagatttttgatgttgactaccagtctctgtcaagaacgacatcaacagagcta
ttttccctgcgcaaggggacgtttaaggatcggctcaattgggcggtaacctgcagcgat
gggatggagttcgatgagtatgacagcgagcatacaacctatctgttgggggtgaaggat
aacgatgtggtgtgcagcgtacgcttaattgaaacctgtcatcacaacatgattgtcggc
acgtttttccgctactttgagaaaggcgagatcccggccagcagccagttttttgaatcc
agccgcttctttgtcgataagcgccgcgcccgaactctgctgggcaatcaatatccgctg
tgtcatctcctgtttctcgccatgattaactatacgatggcctctggtcaccgcggtatt
tatacgattgtcagccattcgatgctgcggattttgacccgctccggctggaatattacc
gtggtggagcgcggcgtctcggagaaagcgcaggatatctatctagtctatttaccgacg
gatgcggcgaaccagcgtctgctgatagagcgtattaatcaggatcagccttttgatgag
gaagccctgcagagttggcctctggtactgaaggccgatacgcttagccctcaatcggct
taa

DBGET integrated database retrieval system