KEGG   Edwardsiella piscicida C07-087: ETAC_12500Help
Entry
ETAC_12500        CDS       T02509                                 

Definition
(GenBank) potassium-transporting ATPase subunit A
  KO
K01546  potassium-transporting ATPase potassium-binding subunit
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_12500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KdpA
Motif
Other DBs
NCBI-ProteinID: AGH74621
Position
2814219..2815916
Genome map
AA seq 565 aa AA seqDB search
MFTHALMLIGLLMLPLLILAPPLGSLLSRLIDGEPYRAMARTENALWRLCGVTPHEMDWR
HYLLAILAFNLLGIVLLFALLMAQGLLPLNPQGFPGLRWDLALNTAVSFVTNTNWQAYSG
ESSLSYLSQMAGLGVQNFLSAASGIAVLFALIRAFARHADPMLGNAWVDLWRITLYVLLP
LSLLLSLFFVSQGVLQNFSAYVSVAPLEGGTQLLPMGPVASQEAIKLLGTNGGGFFGANS
AHPFENPTALSNLLQMVAILLLPTALCFAFGRSVGDSRQGHALLWTMSLIFIVAAGSVMY
AELQGNPHLMALGADDSANMEGKESRFGILSSALYAVVTTAASCGAVNAMHDSFTALGGM
VPMWLMQIGEVVFGGVGSGLYGMLLFVLLTVFIAGLMIGRTPEYLGKKIGVYEMKMTALA
ILIPPALVLTGSAIALLCDAGRSAILNPGAHGFSEVLYAFSSAANNNGSAFGGLSVNTPF
YNLLLALAMLLGRFGVIVPVMAIAGALALKKRQPAGNGTLHTHGALFVGLLVGTILLVGA
LTFIPALALGPLAEQLQMTLSGVRP
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtttacccatgccttgatgctaatcggtctgctgatgctgccgctgctgattctggcc
ccaccgctgggcagcctgctgagccgcctgatcgacggcgagccgtaccgcgccatggcg
cgtacggagaacgccctgtggcgcctgtgcggcgtgacgccccatgaaatggactggcgt
cactacctgctggccatcctcgcctttaacctgttggggatcgtgctgctgttcgcgctg
ctgatggcgcaggggctactgcccctcaaccctcagggattccccggcctgcgctgggat
ctggccctcaataccgccgtcagctttgtcaccaataccaactggcaggcctacagcggc
gagagcagcctgagctacctcagccagatggccggactcggcgtacaaaactttctgtcg
gcggccagcggcatcgccgttttgtttgccctgatccgcgccttcgcccgccacgccgat
ccgatgctgggcaatgcctgggtcgatctgtggcgcatcaccctgtatgtcctgctgccg
ctgtcgctgctgctgagcctattttttgtcagtcagggcgtgctgcagaattttagcgcc
tatgtcagcgtggcaccgctggaggggggcacacagctgctgccgatgggaccggtcgcc
tcccaggaggccatcaagctgctcggcaccaacggcggcggctttttcggcgcgaactcc
gctcacccgtttgaaaacccgaccgcgctgagcaacctgctgcagatggtggcgatcctt
ctgctgccgaccgccctgtgcttcgcctttggtcgcagcgtcggcgacagccgtcagggc
cacgccctgctgtggaccatgtcgctgatctttatcgttgccgcgggctcggtgatgtac
gccgagctgcagggtaacccgcacctgatggcgctgggcgccgacgacagcgccaacatg
gagggtaaggagagccgcttcggcatcctctcctccgccctgtatgccgtggtcacgacg
gcggcctcctgcggcgcggtgaacgccatgcacgactccttcaccgccctgggcggcatg
gtgccgatgtggctgatgcagataggcgaggtggtcttcggcggcgtaggcagcggcctg
tacggcatgctgctgttcgtgctgctgaccgtcttcatcgccgggctgatgatcggtcgc
accccggagtacctggggaaaaagatcggcgtctatgaaatgaaaatgaccgccctggcc
attctgatcccgccggccctggtactcaccggcagcgccatcgcgctgctgtgcgacgcc
ggacgcagcgcgatcctcaatccgggcgcccacggcttcagtgaggtgctgtacgccttc
tcctccgccgccaacaacaacggcagcgccttcggtggcctgagcgtcaatacgccgttt
tacaacctgctgctggcgctggccatgctgctgggacgcttcggggtgatcgtgccggtc
atggcgatcgccggcgcgctggcgctgaaaaagcgtcagccggcgggcaacggcacgctg
cacacccacggcgcgctgttcgtcggcctgctggtgggcaccattttgctggtgggcgcc
ctgacctttattccggcgctggccctcggcccgctggcggaacagttacagatgacgctg
agcggcgtacggccataa

DBGET integrated database retrieval system