KEGG   Edwardsiella piscicida C07-087: ETAC_12505Help
Entry
ETAC_12505        CDS       T02509                                 

Definition
(GenBank) potassium-transporting ATPase subunit B
  KO
K01547  potassium-transporting ATPase ATP-binding subunit [EC:7.2.2.6]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_12505
Enzymes [BR:etc01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.6  P-type K+ transporter
     ETAC_12505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase E1-E2_ATPase HAD Hydrolase_3 CBS SUR7
Motif
Other DBs
NCBI-ProteinID: AGH74622
Position
2815934..2818000
Genome map
AA seq 688 aa AA seqDB search
MSHKQRALFEPALLKTALRDALRKLDPRVQWHNPVMFVVYLGSLLTSFIWLMILCGQTDG
SAIFTGSLALWLWFTVLFANLAEALAEGRSKAQAESLKGVKKSGWAKQLSQAQYGAPWQK
VAAESLRKGDLVLVEAGDTLPCDGEVLEGGASVDESAITGESAPVIRESGGDFSSVTGGT
RVLSDWLVVQCSVNPGETFLDRMIAMVESAKRRKTPNEIALTILLIALTIIFLLACATLY
PFSLFSAQVSQMGSPVTVTVLVALLVCLIPTTIGGLLSAIGVAGMSRMLGANVIATSGRA
VEAAGDVDVLLLDKTGTITLGNRQASEFLPVSGVSEQALASAAQLASLADETPEGRSIVV
LAKQRFNLRERDLNSLNATFVPFSAQTRMSGVNIQGRMIRKGSVDAIRRYVESASGHFPR
SVEEAVERVARSGATPLVVAEDARILGVVALKDIIKGGIKERFAELRRMGIKTVMITGDN
RLTAAAIAAEAGVDDFLAEATPEAKLALIRQYQAEGRLVAMTGDGTNDAPALAQADVAVA
MNSGTQAAKEAGNMVDLDSNPTKLIEVVHIGKQMLMTRGSLTTFSIANDVAKYFAIIPAA
FAATYPQLNQLNVMHLSSPASAILSAVIFNALIIVFLIPLALRGVSYRPLSAGALLRRNL
WIYGAGGLLVPFAGIKIIDLFLTLCGLV
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgagtcataaacagcgtgcactattcgaaccggccctgctgaaaacggcgctgcgcgat
gcgctgcgcaagctggatccccgcgtccagtggcacaacccggtgatgttcgtggtctac
ctgggcagcctgctgaccagctttatctggctgatgatcctgtgcggccagaccgacggc
agcgccatcttcaccggcagcctggccctgtggctgtggtttaccgtgctgtttgccaac
ctggccgaggcgctggccgaaggacgcagcaaggcgcaggccgagagccttaaaggggtg
aagaagagcggctgggccaaacagctgtcgcaggcgcagtacggcgccccgtggcagaag
gtggccgccgaaagcctgcgcaaaggcgacctggttctggtcgaggcgggcgataccctg
ccctgcgacggcgaggtgctggagggcggtgcatcggtggacgaaagcgccatcaccggg
gagtcggcgccggtgatccgcgagtccggcggcgacttctcctcagtcaccggcggcacg
cgagtgctctccgactggctggtggtgcagtgcagcgtcaaccccggagaaaccttcctt
gaccggatgatcgccatggttgaaagcgccaagcggcgcaagacgcccaacgaaattgcg
ctaaccatcctgctgatcgccctgacgataatctttttactggcctgcgccactctgtac
cccttttcgctgttcagcgcacaggtcagccagatgggaagcccggtgaccgtgaccgtg
ctggtggcgctgttagtctgcctgatccccaccaccatcggcggcctgctgtccgccatc
ggcgtcgccggcatgagccgaatgctgggcgctaacgtgatcgccaccagcggccgggcg
gtcgaggccgccggggatgtcgacgtcctgctgctggacaagaccggcaccatcaccttg
ggcaaccgccaggcctccgagtttctgccggtcagcggcgtcagtgagcaggcgctggcc
agcgccgcgcagctggcctccctggcggacgaaaccccggagggacgcagcatcgtagtg
ctggccaagcagcgttttaacctgcgcgagcgcgacctgaacagcctgaacgccaccttc
gtccccttctccgcccagacccgcatgagcggggtcaacatccagggccgcatgatccgc
aaaggctccgtcgacgctatccgccgctacgtcgagtccgccagcggccacttcccccgc
tcggtggaggaggccgtcgagcgcgtggcgcgcagcggcgccaccccgctggtggtggcg
gaggacgcccgcatcctcggcgtcgtcgcgctgaaggatatcatcaagggggggatcaaa
gagcgcttcgccgagctgcggcgcatggggatcaaaacggtgatgatcaccggcgataac
cgcctgaccgccgccgccatcgccgccgaggcgggggtagacgacttcctggccgaggcg
acgccggaggccaagctggcgctgatccgccagtatcaggccgaagggcgtctggtcgcc
atgaccggagacggcaccaacgacgccccggcgctggcccaggccgacgtggcggtggcg
atgaactccggtacccaggcggccaaagaggccggcaacatggtcgatttggactccaac
ccgaccaagctgatcgaggtggtgcacatcggcaagcagatgctgatgacgcgcggttcg
ctgaccaccttcagcatcgccaacgatgtggccaagtacttcgccatcatcccggccgcc
tttgccgccacctacccgcagctcaaccagctcaacgtgatgcacctgagctcaccggcg
tcggccatcctgtcggcggtgatcttcaacgcgctgatcatcgtcttcctgatcccgctg
gccctgcgcggcgtcagctaccgcccgctgagcgccggcgcgctgctgcggcgtaacctg
tggatctacggcgccggcggcctgctggtccccttcgccgggatcaagattatcgatctg
tttttaacgctgtgcggcctggtctaa

DBGET integrated database retrieval system