KEGG   Edwardsiella piscicida C07-087: ETAC_12510Help
Entry
ETAC_12510        CDS       T02509                                 

Definition
(GenBank) Potassium-transporting ATPase subunit C
  KO
K01548  potassium-transporting ATPase KdpC subunit
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_12510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KdpC
Motif
Other DBs
NCBI-ProteinID: AGH74623
Position
2818023..2818643
Genome map
AA seq 206 aa AA seqDB search
MALSLLRPTLMMMLILTLITGVAYPLLSTALAQLMFPQQANGSLLLRDGHPVGSALIGQS
FQRDDYFWPRPSATAERPYNAMASGGSNLAISNPLLTQTLAARAERLRQRDAQEPVGEPI
PVDLLTSSASGLDPDISPQAAHYQAARIAAARGVPPALIDALIAQNTEPRWPTFIGQPTV
NVLRLNLALDRLSSDPALRHPSSPSE
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggcgctatcgctgttacgccccaccctgatgatgatgctgatcctgacgctgatcacc
ggcgtcgcctacccgctgctgagtacggcgctggcgcagctgatgttcccccagcaggcc
aacggctccctgctgctgcgcgatggccatccggtaggctctgcgctgatcggtcaatca
ttccagcgcgacgactacttttggccgcgcccgtcggccaccgccgagcgtccctacaac
gccatggcgtcgggcggcagcaatctggcgatcagcaacccgctgctgacccagacgctg
gccgcgcgcgccgaacgcctgcgccagcgcgacgcgcaggagcccgtcggcgagccgata
ccggtcgatctgctcaccagctccgccagcggcctcgacccggatatctcgccgcaggcc
gcccattatcaggcggcgcggatcgccgcggcgcgcggcgtgcccccggcgctgatcgat
gccctgatagcccagaacaccgagccgcgctggccgacctttatcggccagccgacggtg
aacgtattgaggctgaatctggcgctggatcggctatcatcggatccggcgctacgccac
ccctcatcgccctctgaataa

DBGET integrated database retrieval system