KEGG   Edwardsiella piscicida C07-087: ETAC_12520Help
Entry
ETAC_12520        CDS       T02509                                 

Definition
(GenBank) DNA-binding transcriptional activator KdpE
  KO
K07667  two-component system, OmpR family, KDP operon response regulator KdpE
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02024  Quorum sensing
Module
etc_M00454  KdpD-KdpE (potassium transport) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_12520
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_12520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_12520
Two-component system [BR:etc02022]
 OmpR family
  KdpD-KdpE [MD:M00454]
   ETAC_12520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AGH74625
Position
2821418..2822047
Genome map
AA seq 209 aa AA seqDB search
MRAALENEGWRVADADGLQRGLIEAATRQPDLIILDLGLPDGDGVEFIRDLRRWSAIPVI
VLSARCDEADKVEALDAGAEDFLSKPFGVAELLARVRVALRRHTRQQQESPLVCFADVQV
DLLARSVTRRGERLHLTPIEFRLLAELIANSGKVLTQRQLLSSVWGPNYVEHSHYLRIYM
GHLRQKLEAEPARPRHLLTETGVGYRFMP
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgccgccctggaaaacgaaggctggcgcgtcgcggacgccgatggcctgcagcgt
ggcctgatcgaggccgcaacccgccagccggatctgatcatcctcgatctggggctgccg
gacggcgacggcgtggagtttatccgcgatctgcgccgctggagcgccattccggtgatc
gtgctctcggcgcgctgcgatgaggccgacaaagttgaggccctcgacgccggcgccgag
gattttctgagcaaacccttcggcgtcgcggagctgctggcgcgagtgcgggtggcgctg
cggcgccatacccgccagcagcaggagagcccgctggtctgcttcgccgacgtccaggtg
gatctgctggcgcgcagcgtcacccggcgcggcgagcggctgcacctcacgccgatcgag
tttcgcctgctggccgagcttatcgccaacagcggtaaggtgctgacccagcgccagctg
ctcagcagcgtctggggacccaactacgtcgagcacagccactacctgcgcatctatatg
ggacacctgcgccagaagctggaggccgaaccggcccgtccgcgccatctactgaccgaa
accggcgtcggctaccgctttatgccgtag

DBGET integrated database retrieval system