KEGG   Edwardsiella piscicida C07-087: ETAC_12525Help
Entry
ETAC_12525        CDS       T02509                                 

Definition
(GenBank) phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00030  Pentose phosphate pathway
etc00052  Galactose metabolism
etc00230  Purine metabolism
etc00500  Starch and sucrose metabolism
etc00520  Amino sugar and nucleotide sugar metabolism
etc00521  Streptomycin biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
Module
etc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
etc_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_12525
   00030 Pentose phosphate pathway
    ETAC_12525
   00052 Galactose metabolism
    ETAC_12525
   00500 Starch and sucrose metabolism
    ETAC_12525
   00520 Amino sugar and nucleotide sugar metabolism
    ETAC_12525
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_12525
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ETAC_12525
Enzymes [BR:etc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     ETAC_12525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AGH74626
Position
complement(2822128..2823768)
Genome map
AA seq 546 aa AA seqDB search
MANHPRAGQPARQSDLINVAQLVAQYYSLRPQADNPSHAVKFGTSGHRGSAQRQSFNEAH
ILAIAQAIAEVRKANGVEGPCFVGKDTHALSEPAFVSVLEVLSANGVEVVVQENNGFTPT
PAVSHAILTHNRRGGALADGIVITPSHNPPEDGGIKYNPTNGGPADTNLTCVIEQRANQL
LAQDLAGVKRLTLDAAWRSGHIHARDLVQPYVEDLRDIVDMPAIQRAGLKLGVDPLGGSG
IEYWQRIGEHYGLDLTLVNDHIDQTFRFMHLDHDGVIRMDCSSESAMAGLLALRDRFDLA
FANDPDYDRHGIVTPAGLMNPNHYLAVAIDYLFRHRPQWGAEVAVGKTLVSSAMIDRVVK
ALDRRLVEVPVGFKWFVDGLFDGSLGFGGEESAGASFLRFNGTPWSTDKDGIILCLLAAE
ITAQTGKNPQQHYDALAARFGSPSYNRLQAPATHAQKAALSRLSPEMVQADRLAGDPITA
RLTRAPGNDAPIGGLKIMTDNGWFAARPSGTEEAYKIYCESFLGAEHRQRIEKEAVDIVS
AVLANA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcacccgcgcgccgggcagcctgcccggcagagcgatttgatcaatgtggct
cagctggttgcacagtattacagcctgcgtccgcaggcggataatccgtcccacgccgtg
aagttcggcacctctggtcaccgcggcagcgcgcagcgccaaagcttcaatgaggcgcac
attctggcgatcgcccaggcgatcgccgaggtgcgcaaggccaacggcgtcgaggggccc
tgctttgtcggtaaagatacccatgcgctctctgagccggccttcgtcagcgtgctggag
gtgctgagcgccaacggcgttgaggtggtggtgcaggagaacaatggctttaccccgacg
ccggcggtgtcacacgccattctgacccataaccgtcgcggcggcgcgctggccgacggt
atcgtgattacgccctcccataacccgcccgaagacggcggcatcaaatacaacccgacc
aacggcggcccggcggataccaatctgacctgcgttatcgagcagcgtgccaaccagctg
ctggcgcaggatctggccggcgtgaagcgtctgacgctggacgcggcctggcgcagcggc
catatccacgcgcgcgacctggtgcagccctacgttgaagatctgcgcgatatcgtcgat
atgccggcgattcagcgcgccggtctgaagctcggcgtggatccgctcggcggctccggt
atcgaatactggcagcgcatcggtgagcattacggcctggatctgacgctggtcaacgac
catatcgatcagaccttccgctttatgcatctggaccacgacggcgtgatccgcatggat
tgctcctcggagagcgccatggcggggctgctggcgctgcgcgatcgcttcgacctggcc
tttgccaatgacccggactatgaccgtcacggcatcgtaacgccggccgggctgatgaac
ccgaaccactatctggccgtggccatcgactatctgttccgccaccgcccgcagtggggg
gccgaggtggccgtgggtaagacgttggtctccagcgcgatgatcgatcgggtggttaag
gcgctggatcgccgcctggtggaggtgccggtcggcttcaagtggtttgtcgacggtctg
tttgacggcagccttggctttggcggcgaagagagcgccggggcatcgttcctgcgcttc
aacggcacgccgtggtctaccgataaggatggcatcatcctgtgcctgctggcggcagag
atcaccgcccagaccggtaagaacccgcagcagcattacgatgcgctggcggcgcgcttt
ggctccccgagctataaccgtctgcaggcgccggcgacccatgcccagaaggcggcgctt
tcccgtctctctccggagatggtgcaggcggaccggctggcgggggatccgatcaccgcc
cgtctgacccgcgccccgggtaacgacgcgccgatcggcgggctgaagatcatgaccgac
aacggctggttcgccgcgcgtccgtccggcaccgaggaggcctacaagatctactgtgaa
agcttcctgggtgcggagcatcgccagcgtatcgagaaagaggcggttgatatcgtgagc
gccgtactggctaacgcgtaa

DBGET integrated database retrieval system