KEGG   Edwardsiella piscicida C07-087: ETAC_12555Help
Entry
ETAC_12555        CDS       T02509                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00511  Other glycan degradation
etc00520  Amino sugar and nucleotide sugar metabolism
etc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ETAC_12555
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ETAC_12555
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:etc03110]
    ETAC_12555
Enzymes [BR:etc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ETAC_12555
Chaperones and folding catalysts [BR:etc03110]
 Intramolecular chaperones
  Others
   ETAC_12555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 CHB_HEX CHB_HEX_C Glyco_hydro_20b
Motif
Other DBs
NCBI-ProteinID: AGH74632
Position
complement(2827541..2830207)
Genome map
AA seq 888 aa AA seqDB search
MKGYKLSVVATALGMLGVSGVAQADQQLVDSISSQVKVNYAVTDNRGAENGVNCAALGAD
WASCNQAVISLTNDGSAIEGKDWAIYFHNIRQILKSGNDQFKITFVTGDLHKIEPTDKFK
GFAAGERIEIPIVGEYWQLFESDVMPRWYVTSPDAKPKVIANTDTEDLRQFVTPFAGDLW
KRIKDDKNVLMTPENRFAKNADVKTLSAASLRGQIMPTPLKLKVHQQDADLARGVSLDLT
VLNTASADVIKQRLGQLGVKQAQKGYPIKTQIATKAFKGDMAVPGAYQLKIGTKGAEVTG
YDQAGVFYGLQSILSLLPANGSAKIATLDAEDAPRFQYRGIELDVGRNFHSLAAVERLLD
QMAAYKLNKFHFHLTDDEGWRIEIPGLPELTEVGGKRCHDLSEQQCLLPQLGSGPDSNNN
GSGYFTRADYIKLLKYAQARHIEVIPEIDMPAHARAAVVAMEARYNKLKAAGNEKGANEY
RLLDPTDDSNTTSVQFYDRHSYLNPCLDSSKRFVDKVIGEMAQMHREAGQPLTTWHFGGD
EAKNIRLGPGYTDVNKPEPGKGMIDLSKEDKPWAKSQMCQAMIKEGKVADMEHLPSYFAV
EVSKMVKDHGIGKMQAWQDGLKDAKDAKAFATPRVGVNFWDTLYWGGFDSANDWANKGYE
VVISNPDYVYMDFPYEVNPQENGYYWGTRFSDERKIFAFAPDNLPQNAETSVDRDGNYFS
AKSDKPWPGAYGLSAQLWSEVVRTDEMMEYKIYPRIMAVAERAWHQAGWEQPYQAGREYK
GGETHLVDQQALLQDWQRFANLMGQRELAKMDKSGVAYRVPQPGARVVNGTLETNVAMPG
LIVEYSVDGGKQWQRYDAKAKPSVSGEVQVRTASPDGKRFSRVESVKS
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggatataaactgagcgtagtcgccacggcactgggtatgctgggcgtttccggc
gtagcgcaggccgatcagcagctggtggacagcatcagcagccaggtgaaggtgaactac
gccgtcaccgacaaccgcggcgcggagaacggcgtcaactgtgcggcgctgggcgccgac
tgggcctcctgcaaccaggcggtgatcagcctgaccaacgatggcagcgccatcgagggg
aaagactgggccatctacttccataacatccgtcagatcctgaagagcggcaacgatcag
ttcaagatcacctttgtgaccggcgatctgcacaagattgagccgacggataagttcaag
ggctttgccgcgggtgagcgcatcgagatccccatcgtcggcgaatactggcagctgttt
gaaagcgacgtgatgccgcgctggtacgtgacctcgccggacgctaagccgaaggtgatc
gccaacaccgataccgaagatctgcgtcagttcgtgacgccgtttgcgggcgacctgtgg
aagcgtatcaaggacgataaaaacgttctgatgacgccggagaaccgctttgccaagaac
gccgatgtgaagaccctgtcggcggccagcctgcgcggccagatcatgccgacgccgctg
aagctgaaagtgcatcagcaggacgccgatctggcgcgcggcgttagcctggatctgacg
gtgctgaacaccgccagcgccgatgttatcaagcagcgtctgggccagctgggcgtgaag
caggcccagaagggctacccgatcaagacgcagatcgccactaaagcctttaaaggcgat
atggcggtaccgggcgcgtaccagctgaagatcggcaccaagggcgcggaggtgaccggc
tacgatcaggccggggtgttctacggtctgcagtctatcctgtcgctgctgccggccaac
ggcagcgctaagatagccacgctggacgccgaagatgcgccgcgcttccagtaccgcggc
attgagctggacgtgggccgtaacttccactctctggccgctgtcgagcgcctgctggat
cagatggcggcgtacaagctgaacaagttccacttccatctgaccgacgatgagggctgg
cgtattgagatcccgggcctgccggagctgaccgaagtcggcggcaagcgctgtcatgac
ctgagcgagcagcagtgcctgctgccgcagctgggctctggcccggacagcaataacaac
ggcagcggctactttacccgcgccgactatatcaagctgctgaagtatgcccaggcgcgc
cacattgaggtgatccccgagatcgacatgccggcccacgcccgtgcggcggtggtggcg
atggaggcgcgttacaacaagctgaaggccgccggtaacgagaagggcgccaacgagtac
cgcctgctggatccgaccgatgactctaacaccacctcggtgcagttctacgatcgtcac
agctacctcaacccgtgcctggactcctccaagcgttttgtcgacaaagtgattggcgag
atggcccagatgcaccgcgaagccggtcagccgctcaccacctggcactttggcggcgat
gaggcgaagaacatccgcttagggccgggctataccgacgtgaacaagccggagccgggc
aaggggatgatcgacctgagcaaagaggacaagccgtgggcgaagtctcagatgtgccag
gcgatgatcaaagagggcaaggttgccgacatggagcacctgccgagctacttcgcggtc
gaagtcagcaagatggtcaaggaccacggcatcggcaagatgcaggcctggcaggatggc
ctgaaggatgccaaggatgccaaggcatttgcgacgccgcgcgtcggggttaacttctgg
gataccctgtactggggtggctttgactcggccaacgactgggccaataaaggctatgag
gtggtgatctccaacccggattacgtctatatggacttcccgtacgaggtcaatccgcag
gagaacggctactactggggcacccgcttcagcgatgagcgcaagatctttgccttcgcg
ccggacaacctgccgcagaacgccgaaacgtcggtcgatcgcgacggtaactacttcagc
gccaagagcgacaagccgtggccgggcgcctatggcctctctgctcagctgtggagcgaa
gtggtgcgtaccgatgagatgatggagtacaagatctatccgcgcatcatggccgtcgcc
gagcgtgcgtggcatcaggcgggctgggaacagccgtatcaggctggacgtgaatacaag
ggcggcgaaacccacctggtcgatcagcaggccctgctgcaggactggcagcgctttgcc
aacctgatggggcagcgtgagctggccaagatggacaagtctggcgtggcctaccgcgta
ccgcagccgggtgcccgcgtcgtgaacggcacgctggagaccaacgttgcgatgccgggc
ctgatcgtggagtactccgtcgacggcggtaagcagtggcagcgctatgatgccaaggcg
aagccgagcgtgagcggtgaggtacaggtgcgtaccgcatcgccggacggcaagcgcttt
agccgcgtggagtccgtcaagtcctga

DBGET integrated database retrieval system