KEGG   Edwardsiella piscicida C07-087: ETAC_12610Help
Entry
ETAC_12610        CDS       T02509                                 

Gene name
ubiF
Definition
(GenBank) 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase
  KO
K03184  3-demethoxyubiquinol 3-hydroxylase [EC:1.14.99.60]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00130  Ubiquinone and other terpenoid-quinone biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
Module
etc_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    ETAC_12610 (ubiF)
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.60  3-demethoxyubiquinol 3-hydroxylase
     ETAC_12610 (ubiF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 DAO Pyr_redox_2 Trp_halogenase Pyr_redox NAD_binding_8 FAD_binding_2 HI0933_like FAD_oxidored GIDA Lycopene_cycl NAD_binding_9 NAD_binding_7 SE 3HCDH_N Pyr_redox_3 Thi4 AlaDh_PNT_C ApbA UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AGH74643
Position
complement(2844693..2845868)
Genome map
AA seq 391 aa AA seqDB search
MVQDAGGIVVVGGGMVGAAAALGLAQAGLRVTVLENSPPPPFVADSDPDLRISAISMASV
RLLEQLGVWSAVCAMRAVPYRGLETWEWASSTVSFRAETLGLPCLGFMLENRVLQRALWQ
ALEACEGVTLYTGAALQQLQRDGQGWRLALDNGERLYAGLVIAADGAESRVRSQAGIGVH
GWQYRHDCMLISVKTSPVPQDVTWQQFTPDGPRAFLPLWPGWGSLVWYDSPARIRQLLAM
PLAQLNEAIPRTFPARLGPVQAVAAAAFPLIRRHALRYVDQGLLLLGDAAHTINPLAGQG
VNLGYRDVSALLEVVPAAAARGEAWQTQAVLQRYQRRRLGDNLLMQSGMDLFYGAFSNRL
PPLTLLRNLGLMAAERAGGLKARALRYAIGL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggttcaggacgcgggcggtattgtggtggtcggcggtgggatggtgggcgccgcagcg
gctctggggctagcgcaggccggtctgcgggtgacggtgctggaaaacagcccgccgccg
ccgtttgtcgcggacagcgatcccgatctgcgcatctctgccatcagtatggccagcgtg
cgcctgctggagcagctcggggtgtggtcggcggtatgcgcgatgcgcgcggtgccctac
cgcgggctggagacctgggagtgggcgtcgtcaacggtttcgtttcgcgccgagacgctc
ggtctgccgtgcctgggctttatgctggagaaccgggtgctgcagcgcgcgctgtggcag
gcgctggaggcctgcgagggcgtcacgctgtataccggggcggcgctgcagcagttacag
cgcgacgggcaggggtggcggctggcgctggataacggcgaacggctttatgccggattg
gtcattgcggcggacggcgccgagtcccgggtgcgcagccaggccggcatcggcgttcac
ggctggcagtatcgccacgactgcatgctgatcagcgtgaagacgtcgccggtgccgcag
gatgtcacctggcagcagtttaccccggatggcccgcgggcctttcttccgctgtggccc
ggctggggctcgctggtgtggtatgacagcccggcgcgtatccgtcagttgctggcgatg
ccgctggcgcagctgaatgaggcgatcccgcgtacgtttcccgcccgtctggggccggtg
caggcggtggccgcggcggcgtttccgctgattcggcgccacgcgctgcgctacgtggac
cagggactgctgctgctgggcgatgcggcgcacaccattaacccgctcgccgggcagggg
gttaatctgggctatcgcgacgtgtcggcgctgctggaggtggtgccggcggccgcggcg
cgcggtgaggcgtggcagacgcaggcggtgctgcagcgctatcagcgccgtcgcctgggt
gacaacctgctgatgcagagcgggatggatctcttttacggcgccttcagcaaccgtctg
ccgccgctgacgctgctgcgtaatctggggctgatggcggcggagcgcgccggagggctc
aaggcgcgcgcgctgcgctacgctatcgggctgtag

DBGET integrated database retrieval system