KEGG   Edwardsiella piscicida C07-087: ETAC_12645Help
Entry
ETAC_12645        CDS       T02509                                 

Definition
(GenBank) Glutamate Aspartate periplasmic binding protein precursor GltI
  KO
K10001  glutamate/aspartate transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
etc02020  Two-component system
Module
etc_M00230  Glutamate/aspartate transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_12645
  09132 Signal transduction
   02020 Two-component system
    ETAC_12645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_12645
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamate/aspartate transporter [MD:M00230]
    ETAC_12645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 NMT1 LysR_substrate SDH_C
Motif
Other DBs
NCBI-ProteinID: AGH74650
Position
2853829..2854731
Genome map
AA seq 300 aa AA seqDB search
MRKSVLSLVLLGLSFPLFAAAQDATDGSPTLQKIKDSGVIVVGHRESSVPFSYYDNQQRV
VGYSQDYANAIVDAVKKQLNLPALQVKLLPITSQNRIPLLQNGTYDVECGSTTHNAERQQ
QVAFSNTLFIVGTRLLTAKESGVHDFRDLAGKPVVVTSGTTSEIMLNRMNEKDGMKMRII
SAKDHGDAFRTLESGRAVAFMMDDALLAGERAKAKQPERWVIVGTPQSYEAYGCMLRRDD
PAFKKLVDDTIAHVQTSGQAADGYRRWFEQPIPPKNMNLQFALSDEMKTLFATPNDRIAE
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagtctgtgttatcactagttcttctgggcctgtctttccccctgtttgccgcc
gcgcaggacgctaccgacggctcgccgaccctacaaaaaatcaaagacagcggcgtgatc
gtggtcggccaccgcgaatcctcggtccccttctcctactatgacaatcagcagcgggtg
gtcggctactcccaggactacgccaacgccatcgtcgacgcggtgaagaaacagctcaac
ctgcccgcgctgcaggtcaaactgctgccaatcacctcacagaaccgcatcccgctgctg
caaaatggcacctatgacgtcgagtgcggctccaccacccacaacgccgaacgccagcag
caggtcgccttctccaacaccctgtttatcgtcggcacccgcctgctgacggccaaggag
agcggagtacatgacttccgcgacctggccggtaagccggtggtggtcacctccggcacc
acctcggaaatcatgctcaaccgcatgaacgaaaaggatggcatgaagatgcgcatcatc
agcgccaaggatcacggcgacgccttccgcaccctggagagcgggcgggcggtggccttc
atgatggacgacgcgctgctggcgggggagcgcgccaaggccaagcagcctgaacgctgg
gtgattgtcggcaccccgcagtcctatgaggcctacggctgtatgctgcgccgggacgat
ccggccttcaaaaagctggtcgacgacaccatcgcccacgtgcagacctccggccaggcc
gccgacggctatcggcgctggttcgaacaacccattccgccgaagaacatgaacctgcag
ttcgccctctccgatgagatgaagacgctgttcgccacccccaacgatcgcatcgccgaa
taa

DBGET integrated database retrieval system