KEGG   Edwardsiella piscicida C07-087: ETAC_12650Help
Entry
ETAC_12650        CDS       T02509                                 

Definition
(GenBank) glutamate/aspartate ABC transporter permease GltJ
  KO
K10003  glutamate/aspartate transport system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
etc02020  Two-component system
Module
etc_M00230  Glutamate/aspartate transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_12650
  09132 Signal transduction
   02020 Two-component system
    ETAC_12650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_12650
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamate/aspartate transporter [MD:M00230]
    ETAC_12650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AGH74651
Position
2854817..2855557
Genome map
AA seq 246 aa AA seqDB search
MSIDWNWGIFLQPAPFGGTTYLGWIWSGMQVTVALSLAAWVIAFLLGSLLGILRTLPSRP
LAMIGAIYVELFRNVPLIVQFFTWYLVVPELLPTDWGNWFKGELDPSIQFFVSSLLCLGL
FTAARVCEQVRAAIQSLPAGQKSAGLAMGFTLPQTYRYVLLPNAYRVIVPPLTSEMLNLV
KNSAIASTIGLMEMAAQAGKLLDYSAHAYESFTAITLAYIAINGLLMLAMHLLERRLQLP
GSMGSR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcgattggaactggggcatctttctgcagccggcccccttcggcggcaccacc
tacctgggctggatttggtccggcatgcaggtcaccgtcgctctgtcgctggcggcctgg
gtcatcgcctttctcctcggctcgctgctggggatcctgcgcaccctgcccagccgtccg
ctggccatgattggcgctatctatgtcgagctgttccgcaacgtcccgctgatcgtccag
ttttttacctggtatctggtggtgccggagctgctgccgaccgactggggcaactggttc
aaaggcgaactggacccgtcgatccagttttttgtctcctcgctgctgtgcctggggctg
tttaccgccgcccgggtctgcgagcaggtgcgcgccgccattcagtctctgccggccggg
cagaagagcgccggactggccatgggcttcaccctgccgcagacctaccgctatgtcctg
ctgcccaacgcctatcgggtgatcgtaccgccgctgacctctgagatgctcaatctggtc
aagaattcggccatcgcctccacgatcgggctgatggagatggccgcccaggccggcaag
ctgctggactactcggcgcatgcctatgaatccttcaccgccatcactctggcctatatc
gccatcaacggcctgctgatgctggccatgcacctgctggagcggcgactgcagctgccg
ggcagcatggggagccgctaa

DBGET integrated database retrieval system