KEGG   Edwardsiella piscicida C07-087: ETAC_12660Help
Entry
ETAC_12660        CDS       T02509                                 

Definition
(GenBank) Glutamate Aspartate transport ATP-binding protein GltL
  KO
K10004  glutamate/aspartate transport system ATP-binding protein [EC:7.4.2.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
etc02020  Two-component system
Module
etc_M00230  Glutamate/aspartate transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_12660
  09132 Signal transduction
   02020 Two-component system
    ETAC_12660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_12660
Enzymes [BR:etc01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     ETAC_12660
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamate/aspartate transporter [MD:M00230]
    ETAC_12660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 RsgA_GTPase AAA_29 AAA_16 AAA_33 IstB_IS21 Rad17 RNA12 AAA_30 NTPase_1 DLIC AAA_18 ATPase_2 AAA_7 AAA_25 cobW Guanylate_kin AAA_24 AAA_23 AAA_13 Septin TK Mg_chelatase T2SSE Viral_helicase1 RebB RNA_helicase ATPase ATP_bind_1 NB-ARC
Motif
Other DBs
NCBI-ProteinID: AGH74653
Position
2856231..2856956
Genome map
AA seq 241 aa AA seqDB search
MISLQQVSKWYGQFQVLSDCSTHVDKGEVVVVCGPSGSGKSTLIKTVNGLEPIQQGQICV
NGTAVHDRRTDLARLRSRVGMVFQHFELFPHLSIIDNLTLAQVKVLGRAAPLAVSKGQAL
LDRVGLAAHAAKFPAQLSGGQQQRVAIARALCMDPVAMLFDEPTSALDPEMINEVLDVMV
SLAREGMTMMVVTHEMGFARKVANRVIFMDEGHIVEDREKDAFFSQPHSARARDFLAKII
H
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgatctccctgcaacaggtcagtaaatggtatggacagtttcaggtgctgagcgactgc
agcacccacgtcgacaagggcgaggtggtggtggtctgcggcccctcgggatccggcaaa
tcgaccctgatcaaaaccgtcaacgggctggagccgatccagcaggggcagatctgtgtc
aacggcaccgcggtgcacgatcgccgcaccgatctggcgcgtctgcgctcgcgggtaggc
atggtctttcagcacttcgagctgtttccgcacctgtcgatcatcgataacctgaccctg
gcccaggtcaaggtgctgggacgcgccgcgccgttggcggtcagcaaggggcaagcgctg
ctggatcgcgtcggcctggcggcgcacgccgccaagtttcccgctcagctctccggcggc
cagcagcagcgcgtcgccattgcccgggcgctgtgcatggatccggtggcgatgctgttc
gacgagccgacatcggccctcgatccggagatgatcaacgaggtgctggacgtgatggtc
tccctggcaagagaggggatgaccatgatggtggtcacccatgagatgggattcgcccgc
aaggtggccaaccgggtgatctttatggatgagggacacatcgtcgaagatcgcgagaaa
gatgccttcttcagccagccccactcggcgcgggcgcgcgattttctggccaagatcatc
cactag

DBGET integrated database retrieval system