KEGG   Edwardsiella piscicida C07-087: ETAC_13025Help
Entry
ETAC_13025        CDS       T02509                                 

Definition
(GenBank) Methylenetetrahydrofolate dehydrogenase (NADP+) / Methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00670  One carbon pool by folate
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc01200  Carbon metabolism
Module
etc_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ETAC_13025
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     ETAC_13025
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     ETAC_13025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH AlaDh_PNT_C OCD_Mu_crystall
Motif
Other DBs
NCBI-ProteinID: AGH74726
Position
2931679..2932536
Genome map
AA seq 285 aa AA seqDB search
MTAKIIDGKTIAQQVRSEVAARVRQRLADGKRAPGLAVIMVGDDPASRIYVGSKQRACEE
VGFLSRSYALPDSTDEAQLLTLIDTLNADAAIDGILVQLPLPVGIDNSRVLERIHPDKDV
DGFHPYNLGRLCQRTPKLRPCTPRGIITLLERCGIETQGMDAVMVGASNIVGRPMALELL
LAGCTTTITHSRTRNLQQHVERADLIVAAVGKPGFIPGEWVKPGAVVIDVGINRLESGKV
VGDVDFAGAAQRASWITPVPGGVGPMTVATLMQNTLQACEAFHDD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaaaaattattgatgggaaaacgattgcgcagcaggtcagaagtgaagtggcg
gcacgggtgcgacagcgcctggcggacggcaaacgggcgccgggactggcggtcattatg
gtcggtgacgatccggcctctcgcatctacgtcggcagcaagcagcgcgcctgtgaagag
gtcggctttctctcccgctcctatgcgctgccggacagcaccgatgaggcccagctgctg
acgctgatcgatacgctcaacgccgacgcggccatcgacggtattctggtacagctaccg
ctgcccgtcggcatcgataacagccgcgtgctggaacgcatccatccggacaaagacgtg
gatggttttcacccctataacctgggccgcctatgccagcgtacccccaagctccgcccc
tgcaccccgcgcggtatcattaccctgctggagcgctgcggcatcgaaacccaggggatg
gatgccgtgatggtcggcgcctccaacatcgtggggagaccgatggcgctggagctgctg
ctggccggctgcactaccaccatcacccacagccgcacccgtaacctgcagcagcacgtc
gagcgcgccgatctgatcgtcgccgccgtcggtaaacccggctttatccccggcgaatgg
gtcaagcccggcgcggtggtgatcgatgtcggcatcaatcggttggaaagcggtaaggtg
gtcggcgacgtcgactttgccggtgccgcccagcgcgccagctggattaccccggttccc
ggcggcgtcgggccgatgaccgtcgccaccctgatgcagaacaccctgcaggcctgtgag
gcgtttcacgacgactaa

DBGET integrated database retrieval system