KEGG   Edwardsiella piscicida C07-087: ETAC_13055Help
Entry
ETAC_13055        CDS       T02509                                 

Gene name
purE
Definition
(GenBank) N5-carboxyaminoimidazole ribonucleotide mutase
  KO
K01588  5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_13055 (purE)
Enzymes [BR:etc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.18  5-(carboxyamino)imidazole ribonucleotide mutase
     ETAC_13055 (purE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRC
Motif
Other DBs
NCBI-ProteinID: AGH74732
Position
2937376..2937885
Genome map
AA seq 169 aa AA seqDB search
MSASAAPARIAIVMGSKSDWATLQFAAEILTQLELPCHVEVVSAHRTPDKLFHFAEQAAA
RGLQVIIAGAGGAAHLPGMLAAKTLLPVLGVPVQSAALNGVDSLYSIVQMPRGIPVGTLA
IGKAGAANAALLAAQILALHDEALSRRLAAWRQAQSDEVLSHPDPREDA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccagcgccgcaccggccaggatcgccatcgtcatggggtccaaaagcgattgg
gccaccctgcagttcgccgccgaaatcctgacgcagcttgagctgccctgccacgtggag
gtggtatcagcgcaccgtactccggataagctgtttcactttgccgagcaggcggcggcg
cgcgggctgcaggtcatcatcgccggcgccggcggcgcggctcacctgcccggcatgctg
gcggccaaaaccctgctgccggtgctgggcgtaccggtacagagcgccgcgctgaatggg
gtcgacagcctctactcgatagtacagatgccgcgcggcatcccggtcggcaccctggcc
atcggcaaggcgggcgccgccaatgccgccctgctggcggcccagatcctggcgctgcat
gacgaagcgctgagccgccgcctggccgcctggcgccaggcgcagagcgacgaggtgctc
agccatcccgatccgcgggaggacgcatga

DBGET integrated database retrieval system