KEGG   Edwardsiella piscicida C07-087: ETAC_13060Help
Entry
ETAC_13060        CDS       T02509                                 

Definition
(GenBank) phosphoribosylaminoimidazole carboxylase ATPase subunit
  KO
K01589  5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_13060
Enzymes [BR:etc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.18  5-(carboxyamino)imidazole ribonucleotide synthase
     ETAC_13060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp PurK_C
Motif
Other DBs
NCBI-ProteinID: AGH74733
Position
2937882..2938952
Genome map
AA seq 356 aa AA seqDB search
MKPVCVLGDGQLGRMLRQAGEPLGIPVYPVGIEADPHSVPWQQAVITAEIERWPDTPLTR
ELASHPAFINRDIFPLLADRYSQKQLLDELALPTAPWALLAAPEQWPALFERLGPLAIVK
RRTGGYDGRGQWRIRPGHEPQLDAEIYGQCIVEQGINFIGEVSLIGARAQDGRCVFYPLT
HNLHQDGILRASLVFPQPESFLQEKAQAMLQRIMQRLEYVGVMAMECFVVDDDTLLINEL
APRVHNSGHWTQNGASISQFELHLRALLGLPLPHPDVSTPSVMINLIGTALDTAWLSGPL
VHLHWYDKAVRPGRKVGHLNLNHFQSQRLVSALDTLRGQLPAEYQDALAWAGARLS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggtttgcgtactgggcgatggccagctggggcgcatgctgcgtcaggccgga
gaaccgctggggatcccggtctatccggtgggtatcgaggccgatccgcacagcgtcccc
tggcaacaggcggtgatcaccgccgaaatcgaacgctggcccgacacgccgctgacccgc
gagctggccagccacccggccttcatcaaccgcgatatcttcccgctgctggccgatcgc
tacagccaaaagcagctgctggacgaactggcgctgccgacggcgccctgggcgctgctg
gccgcgccagaacagtggcccgccctgtttgaacgcctcggcccgctggccatcgtcaag
cgccgcaccggcggctatgacgggcgcggtcagtggcgtatccgccccggtcacgaaccc
cagcttgatgccgagatctacgggcagtgtattgtcgagcaagggatcaacttcatcggc
gaggtctcgctgatcggcgcccgcgctcaggatggccgctgcgttttctatcccctcacc
cataacctgcatcaggacggtattctgcgcgccagcctggtctttccgcagccggagagc
tttctgcaggagaaggcgcaggcgatgctgcagcgcatcatgcaacgcctggagtatgtc
ggcgtcatggcgatggagtgtttcgtggtggatgacgacaccctgctgattaacgagctg
gcgccacgcgtacacaacagcgggcactggacccagaacggcgcctcgataagtcagttc
gagctgcacctgcgcgcgctgctcggcctgcctctgccgcacccggatgtctccaccccc
tccgtaatgatcaacctgatcggcaccgcgctggacaccgcatggctaagcggcccgctg
gtgcacctgcactggtacgataaggcggtccgtccgggacgcaaggtgggccacctcaac
ctgaaccacttccagtcccagcggctggtcagcgccctggataccctgcgcggccagctg
ccggcggagtaccaggacgccctggcatgggccggcgcgcggctgagctga

DBGET integrated database retrieval system