KEGG   Edwardsiella piscicida C07-087: ETAC_13135Help
Entry
ETAC_13135        CDS       T02509                                 

Definition
(GenBank) hybrid sensory histidine kinase BarA
  KO
K07678  two-component system, NarL family, sensor histidine kinase BarA [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00475  BarA-UvrY (central carbon metabolism) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_13135
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_13135
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_13135
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_13135
Protein kinases [BR:etc01001]
 Histidine kinases
  NarL family
   ETAC_13135
Two-component system [BR:etc02022]
 NarL family
  BarA-UvrY (no operon) [MD:M00475]
   ETAC_13135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2222 HATPase_c Response_reg HisKA Hpt HAMP HATPase_c_5 DUF1640 HATPase_c_3 Flg_hook
Motif
Other DBs
NCBI-ProteinID: AGH74748
Position
2955342..2958101
Genome map
AA seq 919 aa AA seqDB search
MTKYSLRARMMILTLAPTLLIGLLLSTFFVVHRYNELQDQLVDAGASIIEPLAVASEYGM
TFRSREAVRQLIGLLHRRHSDIVRAIAVFDSQNNLFVTSNYHHNYAMLQLPDGSPPPTDL
MLSKRGDALILRTPIIAENRLAEDKSAVSAPLGYIAIELDLRSVRLQQYKEVFVATLLLL
ISMCIALLFSYRLMRDVTGPIRNMVNTVDRIRRGQLDSRVEGHMLGELDMLKNGINSMAM
SLTAYHEEMQQNIDQATSDLRETLEQMEIQNVELDLAKKRAQEAARIKSEFLANMSHELR
TPLNGVIGFTRQVMKTPLSATQIDYLHTIERSANNLLTIINDVLDFSKLEAGKLVLEHIP
FMLRETIDEVATLLAPSAHDKGLELTLNVRNDVPEHVLGDPMRLQQVLTNLLGNAIKFTE
KGNIDIRIELRSQTAQAVELEVQVHDTGIGISERQQSQLFQAFRQADASITRRHGGTGLG
LVITQKLINEMGGDIAFHSQPHKGSTFWFHIRLELNHNAPPSSLPLERLQGQTLLYIESN
PVAAQCTLDMLKVTPLQVTYCPQFAQVIPDSHYDILLFGLPVKTSLTTESMQEKLSLALR
LADRVILALPSHTLHDSDTLKARGIRSCLFKPLASSRLLPALMDNALPLRAPQVISPHGA
RLPLTVMAVDDNPANLKLIGALLGELVQHTLLCHSGEEALAAARERHLDIILMDIQMPEM
DGIRTTELLRQQPRHATTPIIAVTAHAINGERERLLRAGMDDYLAKPIDENMLRQLLNRY
SGERPSAPTNAPAPAEPDSADVSLDWGLALRQAANKADLARDMLQMLIEFLPQVRERITR
QLAGEQDSDLCSLIHKLHGSSSYSGVPRLRRLCHYLEQQLRHGTPASDLEPEWLELLDEL
DNVTRAAQGYLTPAPGDEQ
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatacagcctgcgggcgcgcatgatgatcctgactctggccccgacgctgctg
atcgggctgctgctcagcaccttcttcgtcgtgcaccgctacaatgaactgcaggatcag
ctggtcgacgccggcgccagcatcatcgagccgctggccgtcgccagcgaatatggcatg
accttccgcagccgcgaggcggtgcgccaactgatcggcctgctgcatcggcgtcactcg
gacattgtgcgcgccatcgcggtctttgacagccagaataatctgttcgttacctcgaac
tatcaccataactacgccatgctgcagctgccggacggcagcccgccgccgaccgatctg
atgctgagcaaacgcggcgacgcgctgatcctgcgtaccccgatcatcgccgaaaaccgc
ctggcggaagataaaagcgccgtcagcgcgccgctgggctatatcgccattgagctggat
ctgcgctcggtgcgcctgcagcagtataaagaggtctttgtcgccacgctgctgctgctg
atcagcatgtgcattgcgctgctgttctcctaccgtctgatgcgcgacgtcaccggcccc
atccgcaacatggtcaacaccgtcgatcgcatccgccgcggccagctcgatagccgcgtg
gaaggccacatgctgggcgagctggatatgctgaaaaacggcatcaactcgatggccatg
tcgctgaccgcctaccatgaggagatgcagcagaacatcgatcaggccacctccgatctg
cgtgaaaccctggagcagatggagatccagaacgtcgagctggatctggccaagaagcgc
gcccaggaggcggcgcgcatcaagtccgagttcttggccaacatgtcccacgagctgcga
accccgctcaacggcgtgatcggcttcacccgccaggtcatgaaaacgccgctgagcgcc
acccagatagactacctgcacaccattgaacgatcggccaacaacctgctgaccatcatc
aacgacgtgctggacttctccaagctggaggccggtaagctggtgctggagcacatcccg
ttcatgctgcgtgaaaccattgacgaggtggcgaccctgctggcgcccagcgcccatgac
aaggggctggagctgacgctcaacgtacgcaacgacgttccggagcacgtgctgggggat
ccgatgcgcctgcagcaagtgctgactaacctgttgggcaacgcgattaaatttaccgaa
aagggcaacatcgacatccgcatcgagctgcgtagccagaccgcccaggccgtggagctg
gaggtgcaggtgcacgacaccggcatcggtatctccgagcgtcagcagtcccagctgttt
caggccttccgccaggcggatgccagcatcacccgccgccacggcggcaccggcctagga
ctggtgatcacccagaagctgatcaacgaaatgggcggcgacatcgccttccacagtcag
ccccacaaagggtcgaccttctggttccatatccgcctggagctcaaccataacgcgccc
ccctccagcctgccgctggagcggctgcagggccaaaccctgctgtacatcgaaagcaat
ccggtggcggcgcagtgcaccctcgatatgctgaaggtcaccccgctgcaggtcacctac
tgcccgcagttcgcccaggtgatcccggacagccactacgatatcctgctgttcggtctg
ccggtcaagacctctctcacgacggagtcgatgcaggagaagctgagcctggcgctgcgc
ctggccgaccgggtgatcctggcgctgcccagccacacgctgcacgacagcgataccctg
aaggcccgcggcatccgcagctgcctgttcaaaccgctcgccagcagtcgactgctgccc
gcgctgatggataacgccctgccgctgcgggcaccgcaggtgatctctccgcacggcgcc
cgtctgccgctgacggtgatggcggtagacgataacccggccaacctaaaactcatcggc
gccctgctcggcgaactggtgcagcacaccctgctgtgccacagcggtgaagaggcgctg
gcggcggcgcgcgaacgccatctggatatcattctgatggacattcagatgccggagatg
gacggcatccgcaccacggagctgctgcgccaacagccacgccacgccaccacgccgatc
atcgccgtcaccgcccatgcgattaacggcgagcgtgagcgtttactgcgcgccggcatg
gatgactatctggctaagccgatcgacgaaaacatgctgcgccagctgctcaaccgctac
agcggcgagcgtcccagcgcaccgaccaacgcccccgccccggcagagccggatagcgcc
gacgtctccctcgactgggggctggcgctgcgccaggcggccaataaagcggatctggcg
cgcgacatgctgcagatgctgatcgaattcctaccccaggtccgcgagcgaatcacccgc
cagctggcgggcgaacaggacagcgacctgtgcagcctgatccacaagctgcacggcagc
agcagttacagcggggtgccgcgcctgcgcaggctgtgccactatctggagcagcagctg
cgccacggtaccccggccagcgatctggagccggagtggctggagctgctggatgaactg
gacaacgtgacccgcgccgcgcagggctacctcacgccggcgccgggcgacgaacagtaa

DBGET integrated database retrieval system