KEGG   Edwardsiella piscicida C07-087: ETAC_13350Help
Entry
ETAC_13350        CDS       T02509                                 

Definition
(GenBank) serine endoprotease
  KO
K04771  serine protease Do [EC:3.4.21.107]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc01503  Cationic antimicrobial peptide (CAMP) resistance
etc02020  Two-component system
Module
etc_M00728  Cationic antimicrobial peptide (CAMP) resistance, envelope protein folding and degrading factors DegP and DsbA
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_13350
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ETAC_13350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:etc01002]
    ETAC_13350
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:etc03110]
    ETAC_13350
Enzymes [BR:etc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.107  peptidase Do
     ETAC_13350
Peptidases [BR:etc01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   ETAC_13350
Chaperones and folding catalysts [BR:etc03110]
 Other chaperones and cochaperones
  DegP / HtrA
   ETAC_13350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin_2 PDZ PDZ_2 PDZ_6 Trypsin DUF3394
Motif
Other DBs
NCBI-ProteinID: AGH74791
Position
complement(3000746..3002161)
Genome map
AA seq 471 aa AA seqDB search
MKKTTLVLSAVALSLGMALSPMSASAAETSSATTAQALPSLAPMLEKVMPSVVSINVEGS
ATVNNSRVPPQFQQFFGEDSPLCQPGSPFGGSPMCQGGGNAPSKERFKALGSGVIIDAGK
GYVVTNNHVVVNADSIKVQLSDGRRFDAKVIGTDPRTDIALIQLKDAKNLTAIKMADSDN
LRVGDYAVAIGNPYGLGETVTSGIVSALGRSGLNVENYENFIQTDAAINRGNSGGALVNL
NGDLIGINTAILAPDGGNIGIGFAIPSNMVKNLTGQMVEYGQVKRGELGIMGTELNSELA
KAMKIDAQRGAFISQVLPKSAAAKAGLKAGDVIVSLNGKNISSFASFRAEIGTMPVGSKL
ALGIIRDGKPMTVEVTLEQSAQSQVASDNIFSGIEGAELSNAAGGKGVKVDNVKKGSTAA
RIGLQKGDVILGVNQQAIANIGELRKILDAKPPVLALNIQRGDNTLYLLMQ
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaccactttagtattgagtgccgttgcattgagtctgggtatggcgttgagt
ccgatgtcggccagcgcggcagagacctcttccgccaccacagcccaggcgctgccgagc
ctggcaccaatgctggagaaagtgatgccgtccgtggtcagcatcaacgtcgagggcagc
gcgaccgtcaataacagccgcgtgccgccgcagttccagcagttttttggcgaagactcc
ccgctgtgccagccgggttcgccgttcggcggttcgccgatgtgccagggcggcggcaat
gcgccgtccaaagagcgctttaaggcgctgggctccggggtcattatcgacgcgggtaaa
ggctatgtcgtgaccaacaaccacgtggtggtcaacgccgacagcattaaagtgcaactg
agcgacggtcgccgcttcgacgccaaggtgatcggcaccgatccgcgtaccgatatcgcg
ctgatccagctgaaggatgccaagaacctgaccgccattaaaatggcggactctgacaat
ttgcgcgtgggcgactatgcggtggcgatcggcaacccctacgggctgggtgagaccgtc
acctccgggatcgtttccgcgctgggccgcagcggcctgaacgtggaaaactacgaaaac
tttattcagaccgacgcggcgattaaccgcggtaactccggcggtgcgctggtgaacctg
aacggcgatctcatcgggatcaacaccgccattctggcgccggacggcggcaacatcggc
atcggcttcgccattccgagcaacatggtgaaaaacttgaccggtcagatggtggagtac
ggccaggtgaaacgcggtgagctggggatcatggggaccgagctgaactccgagctggcg
aaggcgatgaagatcgacgcccagcgcggcgcctttatcagccaggtgctgccgaagtca
gccgccgcgaaggccgggctgaaagccggtgatgtcatcgtctccctgaacgggaagaac
atctccagcttcgcctctttccgcgctgaaatcggcaccatgccggtcggcagcaagctg
gcgctggggatcatccgcgacggtaagccgatgaccgtggaggtaaccctggagcagagc
gcgcagagccaggtggcctctgacaacatcttcagcggtatcgaaggggccgagctgagc
aatgccgccggtggcaagggcgtgaaggtggacaacgtgaagaaaggctccaccgccgcg
cgtatcggtctgcagaagggcgacgtgatcctgggcgtgaaccagcaggcgatcgctaac
atcggtgagctgcgtaaaattctggatgccaagccgccggtgctggcgctgaacatccag
cgtggcgacaacaccctgtatctgctgatgcagtaa

DBGET integrated database retrieval system