KEGG   Edwardsiella piscicida C07-087: ETAC_13365Help
Entry
ETAC_13365        CDS       T02509                                 

Definition
(GenBank) Vitamin B12 ABC transporter, B12-binding component BtuF
  KO
K06858  vitamin B12 transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00241  Vitamin B12 transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_13365
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_13365
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Vitamin B12 transporter [MD:M00241]
    ETAC_13365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2 ParE_toxin
Motif
Other DBs
NCBI-ProteinID: AGH74794
Position
3004768..3005631
Genome map
AA seq 287 aa AA seqDB search
MTLRRAKRRRGSGGRLSLAALLLGLGLSLTSLQAAALRVISLSPHTTELAYAAGLGDSLV
AASAYSDYPPQAATLEKVASWNGINLERILALKPDLILAWHGGNPRRVLDQLSALGIPLF
YSDPQRVSQVADDLDRLAAYSPHPEQAHRAAAQFRQRLQQLRQRYAQGAPLRVMMQFGNQ
PLFSTSAKTLQSDLLALCGAQNIFADSPVPWPQVSREQVIVRRPQAIVIGGDAAQAAIVT
DYWRPQLRVPVIAVNQDWLNRSGPRILLAAESLCAQLHTLSTAATPR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaccctacgacgcgccaaacgccgccgcggatcgggcggccggctgtcgctggctgcg
ctgctgctgggcctcggcctgagcctgacctcgctgcaggcggcggcgctgcgcgtcatc
agcctgtcgccgcacaccaccgagctggcctacgccgccggcctcggcgatagcctggtc
gccgccagcgcctactccgactacccgccgcaggcggcaacgctggaaaaggtagcctcc
tggaacgggatcaacctggagcgcatcctggcccttaagcccgatctgatcctcgcctgg
cacggcggcaacccccgccgcgtgctcgatcagctgagcgcgctggggatccccctcttc
tactccgatccccagcgcgtgagtcaggtggccgacgatctcgacaggctggcggcctat
agccctcatcccgagcaggcgcaccgcgccgccgcccagtttcgccagcgcctgcagcag
ctgcgccagcgctacgcccagggcgcaccgctgcgggtgatgatgcagtttggcaaccaa
ccgctgttttcgacctccgctaaaacgctgcagagcgatctgctggcgctgtgcggcgca
cagaatatctttgccgacagcccggtgccctggccgcaggtcagccgcgaacaggtgatt
gtgcgtcgtccgcaggcgatcgtcatcggcggcgacgccgcgcaggcggccatcgtcacc
gactattggcgcccccagctcagggtgccggtgatcgccgtcaatcaggactggctcaac
cgcagtgggccgcgcattctgctggctgccgagtccctctgcgcacagctgcatacgctg
agcaccgcggcgacgccccgctga

DBGET integrated database retrieval system