KEGG   Edwardsiella piscicida C07-087: ETAC_13420Help
Entry
ETAC_13420        CDS       T02509                                 

Gene name
guaA
Definition
(GenBank) GMP synthase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc01100  Metabolic pathways
Module
etc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_13420 (guaA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:etc01002]
    ETAC_13420 (guaA)
Enzymes [BR:etc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     ETAC_13420 (guaA)
Peptidases [BR:etc01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   ETAC_13420 (guaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMP_synt_C GATase Peptidase_C26 NAD_synthase tRNA_Me_trans Asn_synthase SNO PAPS_reduct ThiI
Motif
Other DBs
NCBI-ProteinID: AGH74805
Position
complement(3016973..3018550)
Genome map
AA seq 525 aa AA seqDB search
MTQNIHQDRILILDFGSQYTQLLARRVREIGVYCELWAWDVSEAQIREFNPSGIILSGGP
ESTTEAGSPRAPEYVFQAGVPVLGVCYGMQTMAMQLGGRVESSTEREFGYAKVEVTAPGR
LFDGIQDALSANGNAVLDVWMSHGDKVTAIPSDFTTVASTETCPYAIMANEEKRFYGVQF
HPEVTHTHQGQHMLQRFVLEICGCAALWTPATIIEDAVARMREQIGDDEVILGLSGGVDS
SVTALLLHRAIGKRLTCVFVDNGLLRLNEAEQVMDMFGDRFGLNIIHVNAEARFLSALSG
IADPEVKRKTIGRVFVEVFDEEATKLPQVKWLAQGTIYPDVIESAASATGKAHVIKSHHN
VGGLPKEMKLGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEY
CDLLRRADAIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDF
MTAHWAHLPYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaaatattcatcaagatcgtatcctgatcctggatttcggttcacagtacacc
cagttattggcccgtcgcgtgcgtgaaatcggcgtttactgcgagctgtgggcgtgggat
gtcagcgaagcgcagatccgcgagttcaaccccagcggtatcattctgtccggcggcccg
gagagcaccaccgaagccggcagcccgcgtgcgccggagtacgtattccaggccggcgtc
ccggtcctgggcgtctgctacggcatgcagaccatggccatgcagctgggcggtcgcgtg
gaaagctccaccgagcgcgagtttggctatgccaaggtcgaggtcacggcgccgggtcgt
ctgttcgacggcattcaggacgccctcagcgccaacggcaacgccgtgctggacgtgtgg
atgagccacggtgacaaagtgacggcgatcccgtctgacttcaccaccgtcgccagcacc
gaaacctgcccgtacgccattatggccaacgaggaaaaacgcttctacggcgtgcagttc
cacccggaggttacccatacccatcagggtcagcatatgctgcagcgcttcgtgctggag
atctgcggctgcgccgcgctgtggaccccggccaccatcatcgaagacgccgttgcccgc
atgcgtgagcagatcggcgacgacgaggtgatcctcggcctgtccggcggcgtggactct
tctgtcaccgcgctgctgctgcaccgcgccatcggcaagcgcctgacctgcgttttcgtg
gacaacggcctgttgcgcctgaacgaagccgagcaggtgatggacatgttcggcgatcgg
ttcggtctgaacatcatccacgtcaacgccgaagcgcgcttcctctctgcgctgtccggc
atcgccgatccggaggtcaagcgcaagaccatcggccgcgtgttcgtcgaggtgttcgat
gaagaggcgaccaagctgccccaggtcaagtggctggcgcagggcaccatctacccggac
gtgatcgagtccgccgcctctgccaccggcaaggcgcacgtgatcaagtcgcaccacaac
gtgggcggtctgccgaaagagatgaagctgggtctggtcgagccgctgaaagagctgttt
aaggatgaagtgcgcaagatcggtctggagctggggctgccgtacgacatgctgtaccgc
cacccgttcccggggccgggtctgggcgtgcgcgtgctgggcgaagtgaagaaagagtac
tgtgatctgctgcgccgcgccgatgccatcttcatcgaagagctgcacaaggccgacctg
tataacaaggtgagccaggcgtttaccgtcttcctgccggtgcgctccgtcggggtgatg
ggcgatggccgtaagtatgactgggtggtctccctgcgtgcggtggaaaccatcgacttc
atgaccgcgcactgggcgcacctgccttacgacttcctggggcgggtctccaaccgcatc
atcaacgaagtcaacggcatctcccgcgtggtgtacgatatctccggtaagccgccggcc
actatcgagtgggaataa

DBGET integrated database retrieval system