KEGG   Edwardsiella piscicida C07-087: ETAC_13425Help
Entry
ETAC_13425        CDS       T02509                                 

Definition
(GenBank) inosine 5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
Module
etc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_13425
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_13425
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     ETAC_13425
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ETAC_13425
  Exosomal proteins of breast cancer cells
   ETAC_13425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IMPDH CBS NMO FMN_dh His_biosynth TMP-TENI Radical_SAM PK NanE Glu_synthase DHO_dh G3P_antiterm ThiG
Motif
Other DBs
NCBI-ProteinID: AGH74806
Position
complement(3018635..3020101)
Genome map
AA seq 488 aa AA seqDB search
MLRIVKEALTFDDVLLVPAHSTVLPNTAELGTQLTATIRLNIPMLSAAMDTVTEARLAIA
LAQEGGIGFIHKNMSIERQADEVRRVKKHESGVVTDPQTVTPSTTLREVKALTERNGFAG
YPVVTEDNQLVGIITGRDVRFVTDLEQPVTAVMTPKERLVTVKEGEARDVVLQRMHEKRV
EKALVVDDSFHLRGMITVKDFQKAERKPNACKDEHGRLRVGAAVGAGAGNEERIAALVEA
GVDVLLIDSSHGHSEGVLQRIRETRAKFPQLQIIGGNVATAAGAKALADAGVNAVKVGIG
PGSICTTRIVTGVGVPQITAVSDAVAALEGTGIPVIADGGIRFSGDIAKALAAGAACVMV
GSMLAGTEESPGEIELYQGRSFKSYRGMGSLGAMSKGSSDRYFQSDNAADKLVPEGIEGR
VAYKGRLKEIVHQQMGGLRSCMGLTGCATIDELRTKAQFVRITGSGIQESHVHDVTITKE
SPNYRLGS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgctacgtattgttaaagaagccctgacgtttgatgacgttctcttagttcctgcccat
tctaccgttctgccgaacaccgccgaacttggcactcagctgactgccactattcgcctg
aacattcctatgctgtccgccgccatggacaccgtcaccgaagcgcgtctggccattgcg
ctggcgcaggaagggggcattggctttatccataagaacatgtccattgagcgccaggcc
gatgaagtgcgccgggtgaaaaagcacgaatccggcgtggtgaccgacccgcagaccgtg
acgccgagcaccaccctgcgcgaagtgaaggccctgaccgagcgtaacggctttgccggt
tacccggtggtgacggaagataaccagctggtggggatcatcaccggccgcgacgtgcgc
ttcgtgacggacctggagcagccggtcaccgccgtgatgacgccgaaagagcgcctggtg
acggtgaaagagggcgaagcccgcgacgtggtgctgcagcgcatgcacgaaaagcgcgtt
gagaaggccctggtggtggacgatagcttccacctgcgcggcatgatcaccgtgaaagat
ttccagaaggccgagcgcaagccgaacgcctgtaaggatgagcatggccgcctgcgcgtc
ggcgccgccgtcggcgctggtgccggtaacgaagagcgcatcgccgcgctggtcgaggcc
ggcgtcgatgtgctgctgatcgactcctctcacggtcactccgaaggcgtgctgcagcgc
attcgcgaaacccgcgctaaattcccgcagctgcagatcatcggcggcaacgttgcgacg
gccgccggcgccaaggcgctggccgacgcgggggtgaacgccgtcaaagtgggtatcggc
ccgggctcaatctgtaccacccgtatcgtgaccggcgttggtgtaccgcagattaccgcc
gtctctgacgccgtcgccgccctggaagggaccggcattccggtgatcgccgatggcggt
atccgcttctccggcgacatcgccaaggcgttggccgccggcgccgcctgcgtcatggtc
ggctccatgctggccgggaccgaagaatccccgggggaaatcgagctgtaccaggggcgc
tccttcaagtcctaccgtggaatgggctcgctgggcgcgatgtctaagggctcctccgac
cgttacttccagagcgataacgccgccgataaactggtgccggaaggcatcgaagggcgc
gtggcctataaaggccgcctgaaagagatcgtacaccagcagatgggcggcctgcgctcc
tgcatggggctgaccggctgcgccactatcgatgagctgcgcaccaaggcgcagttcgtg
cgaatcaccggctccggtattcaggagagccacgtgcacgacgtgaccattaccaaagag
tcaccgaattaccgtctgggttcttaa

DBGET integrated database retrieval system