KEGG   Edwardsiella piscicida C07-087: ETAC_13590Help
Entry
ETAC_13590        CDS       T02509                                 

Gene name
glyA
Definition
(GenBank) serine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00260  Glycine, serine and threonine metabolism
etc00460  Cyanoamino acid metabolism
etc00630  Glyoxylate and dicarboxylate metabolism
etc00670  One carbon pool by folate
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ETAC_13590 (glyA)
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_13590 (glyA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_13590 (glyA)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    ETAC_13590 (glyA)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ETAC_13590 (glyA)
Enzymes [BR:etc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     ETAC_13590 (glyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SHMT Aminotran_1_2 Beta_elim_lyase Aminotran_5 OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AGH74839
Position
complement(3051223..3052476)
Genome map
AA seq 417 aa AA seqDB search
MLKREMNIADYDAELWQAMQQEVTRQEQHIELIASENYTSPRVMQAQGSQLTNKYAEGYP
GKRYYGGCQYVDQVEQLAIDRAKALFGADYANVQPHSGSQANFAVYTALLQPGDTVLGMN
LAHGGHLTHGSPVNFSGKLYNVVPYGIDAHGRIDYDDLAAQAQQHRPKMIIGGFSAYSGV
VDWARMREIADSIGAYLFVDMAHVAGLVAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLIL
AKGLDEALYKKLNSAVFPGAQGGPLMHVIAAKAVALKEAMEPEFTRYQQQVAKNAKAMVD
VFLQRGYKVVSGGTENHLFLLDLVDKQITGKEADAALGRANITVNKNSVPNDPQSPFVTS
GIRVGTPAITRRGFKEAESRELAGWMCDVLDNIHDEATIADTKQKVLAICERLPVYA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagcgtgagatgaacattgccgattatgatgccgagctgtggcaggcaatgcag
caggaagtgacgcgtcaggagcagcatattgagctgattgcctcggaaaactacaccagc
ccgcgggttatgcaggcgcagggctcccagctgaccaataaatatgccgaaggctacccg
ggcaagcgctattacggcggctgccagtatgtggatcaggttgagcagttggcgattgat
cgcgccaaggcgctgtttggcgccgactacgctaacgtacagccccactcaggttctcag
gccaatttcgccgtctatactgcgctgctgcagccgggtgatacggtgctgggcatgaat
ctggcgcacggcggccacctgacgcacggctctccggttaacttttccggtaagctgtat
aacgtggtgccttacggcatcgacgcgcatggccgtatcgactatgacgatctggcggcg
caggcgcagcagcaccgtccgaagatgatcatcggcggtttctcggcctattccggcgta
gtggactgggcgcgtatgcgtgagatcgccgatagcatcggtgcctacctgtttgtggat
atggcgcacgtggcgggtctggtcgctgccggggtttatcccaatccggttccccatgct
cacgtcgtgaccaccaccacccataagaccctggccggtccgcgcggcggcctgatcctg
gccaaggggttggatgaggctctgtacaaaaagctgaactccgccgtgttcccgggggcg
cagggggggccgctgatgcacgtgatcgcagccaaggcggtcgcgctgaaagaggcgatg
gagcccgagtttacccgttaccagcagcaggtggccaagaatgccaaggcgatggtcgac
gtcttcctgcagcgtggctataaagtcgtgtccggcggcacggaaaaccatctgttcctg
ctggatctggtcgataagcagatcaccggtaaagaggccgatgccgcgctggggcgcgcc
aatattacggtgaataaaaacagcgtgcccaacgatccgcagagcccgttcgtgacctcc
ggtattcgcgtcggcaccccggctatcacacgccgtggctttaaagaggcggagtcccgc
gagctggcgggatggatgtgcgacgtgctggataatatccatgatgaggccacgatcgcc
gataccaagcagaaggtattggctatctgtgaacgcctgccggtctatgcctga

DBGET integrated database retrieval system