KEGG   Edwardsiella piscicida C07-087: ETAC_13655Help
Entry
ETAC_13655        CDS       T02509                                 

Gene name
pheA
Definition
(GenBank) bifunctional chorismate mutase/prephenate dehydratase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
etc_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETAC_13655 (pheA)
Enzymes [BR:etc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     ETAC_13655 (pheA)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     ETAC_13655 (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT
Motif
Other DBs
NCBI-ProteinID: AGH74852
Position
3071733..3072893
Genome map
AA seq 386 aa AA seqDB search
MSTPNPLLTLREQISAVDSQLLALLGERRCLAEQVARTKQALHHPVRDRARERDLLHSLI
EQGKPLQLDAHFITRLFQLIIEDSVLTQQALLQQSHLAVDAAARIAFLGPKGSYSHLAAR
RYAARHFDRVLECGCQRFQDVVAQVESGQADYGVLPIENTSSGAINDVYDLLQHTSLSLV
GELTLPIEHCLLIAGEGDISALTTVYSHPQPFQQCSQFLSRYPQWHIEYCESTAAAMEKV
AALRSPQAAALGSADGGNLYGLQPLAHDLANQAQNMTRFIVLARKAIEVNPHIAAKTTLI
MATGQQPGALVDALLAFREQHIVITKLESRPINGNPWEEMFYLDVQANLNDPAMQRALHD
LRALTRSQKVLGCYPSENVVPVAPTA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagcacacccaatccattattgacgctgcgcgagcagattagcgccgtcgacagccag
ctgctggcgctgctgggcgaacgccgctgcctggccgagcaggtcgcccgcaccaaacag
gcgctgcatcacccggttcgcgaccgggccagagagcgcgatctgctgcacagcctgatt
gagcagggcaaaccgctgcagcttgacgcacattttattactcgcctgtttcaactgatt
atcgaagactcggtgctgacccagcaggcgctgctacagcagtcacacctggccgtcgac
gccgccgcacgcatcgcctttctcggtcccaaaggctcctattcccatctggccgctcgc
cgctatgccgcgcgccattttgatcgggtgctggagtgcggatgccagcgttttcaagac
gtcgtcgcccaggtcgaaagcggccaggccgactatggcgtactgccgatagaaaacacc
tcatccggcgccattaacgacgtctacgatctgctgcagcacaccagcctctccctcgtc
ggagagctaacgctgcctatcgagcactgcctgctgatcgccggagagggcgacatcagc
gcgctgaccaccgtctacagtcacccccagccgtttcagcagtgcagccagttcctcagc
cgctacccacagtggcatatcgaatactgtgaaagcaccgccgccgcgatggagaaggtc
gccgcgctgcgctctccccaggcggcagccctgggcagcgccgacggcggtaatctatat
ggcctgcagccgctggcgcacgatctggccaaccaggcccagaacatgacccggttcatt
gtcctggcgcgcaaagcgatcgaggtcaatccccacatcgccgccaaaaccacgctgatc
atggcgacgggccaacagcccggggcgctggtcgatgcgctgctggccttccgcgagcag
catatcgtcatcaccaagctggagtcgcggccgatcaacggcaatccgtgggaggagatg
ttctacctggatgttcaggcgaatctgaacgacccagccatgcagcgggcgctgcatgac
ctgcgggcgctcacccgatcgcagaaagtcttgggctgctacccgagtgaaaacgtggtg
ccggtcgcaccgaccgcgtaa

DBGET integrated database retrieval system