KEGG   Edwardsiella piscicida C07-087: ETAC_13660Help
Entry
ETAC_13660        CDS       T02509                                 

Gene name
tyrA
Definition
(GenBank) bifunctional chorismate mutase/prephenate dehydrogenase
  KO
K14187  chorismate mutase / prephenate dehydrogenase [EC:5.4.99.5 1.3.1.12]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
etc00401  Novobiocin biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
etc_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETAC_13660 (tyrA)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    ETAC_13660 (tyrA)
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     ETAC_13660 (tyrA)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     ETAC_13660 (tyrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH CM_2 PALP 3HCDH_N NmrA
Motif
Other DBs
NCBI-ProteinID: AGH74853
Position
complement(3072919..3074040)
Genome map
AA seq 373 aa AA seqDB search
MVAELSALRDSIDEVDKALLGLLARRLQLVAQVGEVKSRYGLPVYVPEREAAMLASRRAE
AQQLGVSPDLIEDVLRRVMRESYVSENDKGFKALNPTLRPVVIVGGAGQMGRLFARMLRL
SGYSVRILEPQDWPQAETLCADAGMVMISVPIHLTEAAIARLPPLPSDCLLVDLASVKGG
PMQAMLAAHRGPVVGLHPMFGPDVGSFAKQVIVYCDGRQPQAYQWLLEQLQVWGARLHRI
SAVQHDQNMAFIQALRHFATFAYGLHLAEENVSMEQLLALSSPIYRLELMMVGRLFAQDA
QLYADIIMASPDNLALITRYYQRFGDAIRLLDGQNKEAFIETFQRIARWFGDDAQRFQDE
SRALLSQAHDRRG
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggaactgagcgcactgcgcgatagcattgacgaggtcgataaggcgctgctg
gggctgttggcgcgccgtttacagttggtcgcccaggtgggggaggtcaaaagccgctat
ggtctgccggtctatgtgccggagcgagaggcggcgatgctggcgtcgcgccgcgcggag
gcgcagcagcttggtgtctcgccggatctgattgaggacgtgctgcgtcgggtgatgcgg
gagtcctacgtcagtgaaaatgacaaggggtttaaggcgctgaatccaacgctgcgcccg
gtggtgatcgtcggcggcgcggggcagatggggcggctgtttgcccggatgctgcgcctg
tcgggctactcggtgcgtatactggagccgcaggattggccgcaggccgagacgctttgc
gccgatgccggtatggtgatgatcagcgtaccgatccatttgaccgaggccgcgatagcc
cgcctgccgccgctgccgtcggattgcctgctggtcgatctggcgtcggttaagggagga
ccgatgcaggcgatgctggcggcgcatcgcgggcccgtcgtcgggctacatcccatgttt
ggcccggacgtcggcagctttgccaagcaggtgatcgtctactgcgacggtcgacagccg
caggcttaccagtggctgctagagcagctgcaggtttggggcgctcgcctgcatcgcatc
agcgcggtgcagcacgatcagaatatggcgtttattcaggcgctgcgtcactttgccacc
tttgcctatgggctgcatctggccgaagagaatgtcagcatggaacagctgctggcgctc
tcctcgccgatttatcgtctggagctgatgatggtcggacgcctgtttgcgcaagatgcg
cagctgtatgccgatatcatcatggcatcgccggataatctggcgctgatcacgcgctac
tatcagcgcttcggcgacgcgatcagactgctggacgggcagaataaagaggcgtttatc
gagacgtttcagcgtatcgctcgctggttcggcgacgatgcgcagcgttttcaggatgag
agccgggcgctgctgagtcaggcgcacgatcgccgcggttga

DBGET integrated database retrieval system