KEGG   Edwardsiella piscicida C07-087: ETAC_13690Help
Entry
ETAC_13690        CDS       T02509                                 

Definition
(GenBank) anaerobic C4-dicarboxylate transporter
  KO
K07792  anaerobic C4-dicarboxylate transporter DcuB
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_13690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_13690
Transporters [BR:etc02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ETAC_13690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DcuA_DcuB CitMHS DcuC
Motif
Other DBs
NCBI-ProteinID: AGH74859
Position
3081814..3083157
Genome map
AA seq 447 aa AA seqDB search
MVTLQFAVIIICLLLGTRYGGMGLGLISGIGLFILTFIFDLVPGKPPVEVILTILAVIGC
AAVLQTAGGLNVMMQFAERLLRRHPQHITILAPLTTWMLTFLCGTGHVVYTMFPIIADIA
LKKGIRPERPMAVASVASQMAITASPVSVAVVSLVSILGAAHGIGQAFTILDILAVSVPA
SLCGVLVAALWSLRRGKDLDKDPVFQEKIKDPEQRAYIYGDSQTLLNQTFPKQAYWATWI
FFTAIAVVVILGAFADLRPAFEVKGVMKPLSMNLVIQMMMLIAGAIILMSCKVKPGEISS
GAVFKAGMVAIFSVFGVAWMSDTFFQAHMQDLRLVLEDVVKSHPWTYALVLFLVSKLVNS
QAAALTAIAPMGLSLGVEPKMLLAFFPAAYGYFVLPTYPSDLACIGFDRSGTTRIGKFII
NHSFILPGFIGVITSCTVGYLLVAAFY
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggtcacactacaatttgccgttataataatctgtctattgctagggacacgctatggc
gggatggggctggggcttatcagtggtattggtctcttcatcctgacctttatcttcgat
ctggtgcccggcaagccgccggtcgaggtcatcctgaccattctggccgtcatcggctgc
gccgccgtgctacaaaccgccggcggcctcaacgtgatgatgcagtttgccgaacgcctg
ctgcgtcgtcacccgcagcacatcaccatcctggcgccgttgaccacctggatgctgacg
ttcctctgcggcaccggacacgtggtctataccatgttccccatcatcgccgatatcgcg
ctgaagaaaggtatccgcccagagcgcccgatggcggtcgcctccgtcgcgtcacagatg
gccatcaccgcatcgccggtctccgtcgccgtggtttcactggtctcaatcctcggcgcc
gcgcacggcattggccaagccttcacgattctggatattctggccgtatcggtgccagcc
tcgctgtgcggggtgctggtcgccgcgctgtggagcctgcgccgcggtaaagatctggat
aaagatccggtattccaggagaaaatcaaagatccggagcagcgcgcctacatctatggc
gatagccaaacgctgctgaaccagacgttccccaaacaggcctactgggctacctggatc
ttttttaccgctatcgccgtcgtcgtcatcctgggcgccttcgccgatctgcggccggcc
tttgaggtgaaaggggtgatgaaacccctctcgatgaacctggtcatccagatgatgatg
ctgatcgccggcgccatcatcctgatgtcctgtaaggtcaagccgggcgaaatctccagc
ggcgccgtctttaaagccggtatggtcgctatcttttccgtctttggcgtcgcctggatg
agtgataccttcttccaggcgcatatgcaggatctgcgcctggtgctggaagatgtcgtg
aagagccacccctggacctatgcgctggtgctgtttttggtctccaagctggtgaacagc
caggcggccgcactgaccgccatcgcaccgatggggctatcgctgggcgttgagcccaaa
atgctgctggcgttctttccggcggcctatggctacttcgttctgccgacctaccccagc
gatctggcctgtatcggctttgaccgctcaggaaccacccgcatcgggaaatttattatt
aaccacagctttatcctgcccggttttatcggtgtcatcacctcgtgtacggtaggctat
ctgctggttgccgcattctattaa

DBGET integrated database retrieval system