KEGG   Edwardsiella piscicida C07-087: ETAC_13740Help
Entry
ETAC_13740        CDS       T02509                                 

Definition
(GenBank) S-ribosylhomocysteinase
  KO
K07173  S-ribosylhomocysteine lyase [EC:4.4.1.21]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00270  Cysteine and methionine metabolism
etc01100  Metabolic pathways
etc01230  Biosynthesis of amino acids
etc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ETAC_13740
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_13740
Enzymes [BR:etc01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.21  S-ribosylhomocysteine lyase
     ETAC_13740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LuxS
Motif
Other DBs
NCBI-ProteinID: AGH74869
Position
complement(3090888..3091403)
Genome map
AA seq 171 aa AA seqDB search
MPLLDSFTVDHTRMAAPAVRVAKNMTTPHGDQITVFDLRFCRPNHAILPERGIHTLEHLF
AGFMRDHLNGDGVEIIDISPMGCRTGFYMSLIGTPDEARVAAAWKAAMEDVLRVSDQRSI
PELNEFQCGTYSMHSLDEAHQIARQILAAGIGINHNDALALSADQLARLHP
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgccgttactggatagcttcactgtcgaccatactcgcatggccgcacctgccgttcgc
gtagcaaaaaatatgaccaccccgcacggcgatcagatcaccgtattcgatctgcgcttc
tgccgccccaaccatgccatcctgccggagcgcggtattcatacccttgagcacctattc
gccggttttatgcgtgaccatctgaacggcgacggcgttgagattattgatatttcaccg
atgggctgccgcacgggcttctatatgagcctgatcggaacgccggacgaagcgcgagtt
gccgcggcgtggaaggcggcgatggaggacgtgctgcgggtcagcgatcagcggagtatc
ccagagctgaatgagtttcagtgtggtacctacagcatgcactcgttggacgaggcgcac
cagattgcccgccagatcctggcggccgggatcggtatcaaccataacgatgcgctggcg
ctctctgccgaccaactggcccgtctgcacccctag

DBGET integrated database retrieval system