KEGG   Edwardsiella piscicida C07-087: ETAC_13745Help
Entry
ETAC_13745        CDS       T02509                                 

Definition
(GenBank) glutamate--cysteine ligase
  KO
K01919  glutamate--cysteine ligase [EC:6.3.2.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00270  Cysteine and methionine metabolism
etc00480  Glutathione metabolism
etc01100  Metabolic pathways
Module
etc_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ETAC_13745
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ETAC_13745
Enzymes [BR:etc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.2  glutamate---cysteine ligase
     ETAC_13745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_cys_ligase
Motif
Other DBs
NCBI-ProteinID: AGH74870
Position
complement(3091564..3093123)
Genome map
AA seq 519 aa AA seqDB search
MIPDVSQALSWLESHPHALDGIRRGIERETLRVTPDGHLAATPHPAVLGKALTHPWITTD
FAESLLEFITPVDGSIDHMLDFLSDIHRYVARHLGDERMWPLSMPCFIGSEQDITLAQYG
SSNLGRFKTLYREGLKNRYGALMQTISGVHYNFSLPLSFWQARAGVQDADSGKAAISDGY
FRLIRNYYRFGWVIPYLFGASPAICGSFLNGRESALPFERRGGTLFLPYATSLRLSDLGY
TNKSQSNLGITFNHLDQYVEGLKRAIHTPSAEFARLGVEEDGRYRQLNANILQIENELYA
PIRPKRVTRDGESPSDALLRGGVEYIEVRSLDINPFTPIGVDADQARFLDLFLIWCVLAD
APEMSSDELLCTRQNWNRVILEGRKPGQTIGIGCHDARQPLAYVGQSLFADLHRVAEVLD
GINGDARYQQVCARLVAAFEDVSLTYSARVMAQMGDRGIGSYGLALAQRYRDRLCSEPLT
LLDEATLTAQAQSSVTRQAALESQDSESFADYLRQHAGR
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
ttgatcccggacgtatctcaggcccttagctggctagaatctcatccgcatgccctggac
ggcatccggcgcggtatcgagcgcgaaacgctgcgcgtcactcccgatggtcatttggcc
gcaacgccgcacccggcggtgttgggtaaggcgttgacccacccctggatcaccactgac
ttcgccgaaagcctgctggagttcatcacgcccgtcgatggtagcatcgaccatatgctg
gacttcctcagtgatattcaccgctatgtggcgcgccatctcggcgatgagcgcatgtgg
cccctgagcatgccctgttttatcgggagcgagcaggatatcaccctggcccagtacggc
agcagtaacctagggcgctttaaaacgctctaccgcgaggggttgaagaaccgttatggg
gcgctgatgcagaccatctccggcgtgcactataacttctccctgccgctgtcgttttgg
caggcgcgcgccggcgtgcaggatgcggatagcggtaaggccgccatttccgacggctat
ttccgcctgattcggaactactatcgctttggctgggtgatcccctatctgtttggcgcg
tcaccggccatctgtggctccttcctgaacgggcgggagagcgcgctgccgtttgagcgc
cgcggcggaacgctgttcctgccctatgccacctcgctgcgcctgagcgatctgggatac
accaataagtcgcagagcaatctcgggatcacgtttaaccaccttgaccagtatgtcgaa
gggctgaagcgcgccatccataccccctccgcggagtttgctcgcctgggcgtggaggaa
gacggccgctatcgccagctgaatgccaatattctgcagatcgaaaatgagctctatgcg
ccgatccggcccaagcgcgtgacgcgcgacggtgagtcgccgtccgatgcgctgctgcgc
ggcggcgtagagtacattgaggttcgctctctggacattaacccgttcactcccatcggc
gtcgatgccgatcaggcccgcttcctcgatctgttcctgatctggtgcgtgctggccgat
gcgccggagatgagcagcgacgagctgctgtgtacgcgccaaaactggaaccgggtgatc
cttgaggggcgcaagccggggcagaccatcggcattggctgtcatgatgcccgtcagccg
ctggcgtacgtgggacagtcactttttgccgacctgcatcgggtcgccgaggtgctggat
ggcattaacggtgatgcgcgctaccagcaggtctgcgctcgtctggtggcagcctttgag
gatgtttctctgacctactcggcacgggtcatggcccagatgggggatcgggggatcggc
agctatggcctggcgctggcgcagcgttaccgcgatcggctgtgcagcgagccgctgacg
ctgttggatgaggcgacgctgacggcgcaggcgcagagctcggttacccgccaagcggcg
ctggagtcccaggacagcgagtcctttgcagactatcttcggcagcacgccggacgctag

DBGET integrated database retrieval system