KEGG   Edwardsiella piscicida C07-087: ETAC_13760Help
Entry
ETAC_13760        CDS       T02509                                 

Definition
(GenBank) carbon storage regulator
  KO
K03563  carbon storage regulator
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_13760
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:etc03019]
    ETAC_13760
Messenger RNA biogenesis [BR:etc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     ETAC_13760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CsrA S1
Motif
Other DBs
NCBI-ProteinID: AGH74873
Position
complement(3095599..3095784)
Genome map
AA seq 61 aa AA seqDB search
MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQPTT
Y
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atgcttattctgactcgtcgagtgggtgagaccctcatgattggcgatgaagtaacggtc
accgtgttgggggtgaagggaaaccaggtacgtatcggtgtgaatgctccgaaagaggtt
tctgtgcaccgtgaagagatctatcagcgtattcaggcggaaaagtcccaaccgacgacg
tattga

DBGET integrated database retrieval system