KEGG   Edwardsiella piscicida C07-087: ETAC_13860Help
Entry
ETAC_13860        CDS       T02509                                 

Gene name
ispF
Definition
(GenBank) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
  KO
K01770  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:4.6.1.12]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00900  Terpenoid backbone biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
Module
etc_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ETAC_13860 (ispF)
Enzymes [BR:etc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.12  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
     ETAC_13860 (ispF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YgbB
Motif
Other DBs
NCBI-ProteinID: AGH74893
Position
complement(3123298..3123771)
Genome map
AA seq 157 aa AA seqDB search
MRIGHGFDVHRFGGEGPLIIGGVRIAHPQGLLAHSDGDVALHAATDALLGAAALGDIGKL
FPDTDPAYKGADSRALLREAYRRIRAKGYRLGNLDITLIAQAPKMAPHIPQMRVFLAEDL
QCPIDDVNVKATTTEKLGFTGRGEGIACEAVALLVKE
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggtcacggttttgacgttcaccgcttcggcggcgaagggccgctgattatc
ggcggcgtgcgcatcgcgcacccacaggggctgctggcccattccgatggcgatgtcgcc
ctgcatgcggcgaccgacgccctgctgggggcggcggccctgggggatatcggcaagctg
ttcccggatacggatcccgcctataagggggcggacagccgcgcgctgctgcgtgaggca
taccgtcgcattcgcgccaagggctaccgtctgggtaatctggacattaccctgattgcc
caggcgccgaagatggcgccgcacattccgcagatgcgggtgtttctggccgaggattta
cagtgcccgatcgatgatgtcaacgtgaaggcgaccaccactgaaaagctgggctttacc
ggacgcggcgaggggatcgcctgcgaagcggtggccctgctggtcaaggagtga

DBGET integrated database retrieval system