KEGG   Edwardsiella piscicida C07-087: ETAC_14130Help
Entry
ETAC_14130        CDS       T02509                                 

Definition
(GenBank) shikimate 5-dehydrogenase
  KO
K00014  shikimate dehydrogenase [EC:1.1.1.25]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETAC_14130
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     ETAC_14130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Shikimate_dh_N SDH_C Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AGH74947
Position
complement(3187343..3188167)
Genome map
AA seq 274 aa AA seqDB search
MTRHLSKDTQLCISLAARPGNFGTRFHNYLYDALDLDYLYKAFTTRDIVAAIGGVRALGI
RGCAISMPFKEAVIPLVDEMDASAVGIGSVNTLVNTEGWLKAYNTDYIAIAQLLRQYALD
PAMCFALHGSGGMAKAVACALRDAGFTRGYIVAKNAESGQRLAAQYGYTWCHELPAQAPA
DLLINATPVGMLGGEFADALSFHPARIAQAHAVFEVVALPIATPLVQAARAAGKTVITGA
EVFAIQAVEQFVLYTGIRPEHGLFLQAAAHARGE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgacccgacacctcagcaaggatacccaactgtgcatatcgctggcggcgcgcccgggt
aacttcggcacccgctttcataactatctgtatgacgcgttggatctggattacctgtat
aaggccttcaccacccgcgatattgtcgccgccatcggcggcgtcagggcgctgggcatc
cgcggctgcgctatctccatgccgtttaaggaggcagtgatcccgctggtggatgagatg
gatgcctcggcggtcgggatcggctcggtgaataccctggtgaatacggagggctggctg
aaggcctataacaccgactatatcgccatcgcccagctgctgcgccagtatgcgctcgat
cccgccatgtgctttgccctgcacggcagcggcggcatggccaaggcggtcgcctgtgcg
ctgcgggacgcggggtttacccgtggctatatcgtggcgaaaaacgccgagtccggtcag
cgtctggcggcgcagtatggctatacctggtgccatgagctgccggcgcaggcgccagcc
gatctgctgatcaacgccacgccggtggggatgctcggcggcgagtttgccgacgcgctg
tcgtttcatcccgcgcgtatcgcgcaggcccacgcggtgtttgaggtggtggcgctaccg
atagcgacgccgctggttcaggcggcgcgggcggcggggaaaacggtgatcaccggggcc
gaggtgttcgccattcaggcggtggagcagtttgtcctgtataccggcattcgaccggag
cacgggctatttttgcaggccgccgcccacgcccggggagagtga

KEGG   Edwardsiella piscicida C07-087: ETAC_15210Help
Entry
ETAC_15210        CDS       T02509                                 

Gene name
aroE
Definition
(GenBank) shikimate 5-dehydrogenase
  KO
K00014  shikimate dehydrogenase [EC:1.1.1.25]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETAC_15210 (aroE)
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     ETAC_15210 (aroE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Shikimate_dh_N Shikimate_DH SDH_C Sacchrp_dh_NADP F420_oxidored adh_short Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGH75163
Position
complement(3458777..3459592)
Genome map
AA seq 271 aa AA seqDB search
MQRFAVFGHPIKHSQSPRIHRLFAQQTGIALSYEAMLAPLDDFPAFAMAFFQQGGRGANV
TTPFKEQAWQMVDILTPRARLAGAVNTLHWQNARLLGDNTDGIGLVSDLRRLAMIGDASR
VLLLGAGGAARGVILPLLEQGCRIVLANRTHARAQALAAAFQAQGEIEALPYDALDDHTF
DLIINATASGLQGEVPPLPPSIMRPDCACYDMFYRAGATPFLAWAQQQGAVRLADGFGML
VAQAAHAFSLWHGVMPQIAPVLIELRQEQAG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgatttgccgtttttggtcacccgataaagcacagccagtcgccgcgtatccac
cggctttttgctcaacagaccggtattgcgctcagctatgaggcgatgctggcgccgctg
gatgattttcccgcctttgctatggcctttttccagcagggggggcgaggcgctaacgtc
accaccccctttaaagagcaggcttggcagatggtggatatcttgacgccgcgggcccgt
ctggccggcgcggtgaatacactgcattggcaaaacgcccgtctgctgggggataacacg
gacggtattggactggtcagtgatttacgtcggctggcgatgatcggtgatgcgagtcga
gttttgctgttgggcgcagggggggccgctcgcggcgtgatcctaccgctgctggagcag
gggtgtcggatcgtgctggccaaccgaacccatgcccgggcacaggcgttggccgctgca
tttcaggcgcagggagagattgaggcattgccctacgatgcgcttgacgatcacaccttc
gatctcattattaacgcaaccgcttcagggctgcagggcgaggtcccgccgctgccgccc
tcgatcatgcgcccggattgcgcctgttatgacatgttttatcgcgcgggggcgacgccg
tttctggcctgggctcagcagcagggcgcggtacgcttggctgatggcttcggtatgctg
gtggcgcaggcggcgcacgccttctcgctgtggcatggcgtcatgccgcagatagcgccg
gtgctgatagagctacgtcaggagcaggcgggatga

DBGET integrated database retrieval system