KEGG   Edwardsiella piscicida C07-087: ETAC_14195Help
Entry
ETAC_14195        CDS       T02509                                 

Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00260  Glycine, serine and threonine metabolism
etc00270  Cysteine and methionine metabolism
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_14195
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_14195
   00270 Cysteine and methionine metabolism
    ETAC_14195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_14195
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     ETAC_14195
    1.1.1.399  2-oxoglutarate reductase
     ETAC_14195
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETAC_14195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT NAD_binding_2 ACT_4 AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: AGH74960
Position
complement(3203270..3204508)
Genome map
AA seq 412 aa AA seqDB search
MAKVSLDKDRIKFLLVEGVHQSAVDTLRAAGYNNIEYHKGALDDDALREAIRDAHFIGLR
SRTQLSEAMFAAAEKLVAVGCFCIGTNQVDLAAAQRRGVPVFNAPFSNTRSVAEMVLGET
LLLLRNIPQANACAHRGEWSKQAVGCYEARGKKLGIIGYGHIGTQLGILAEGIGMDVYFY
DIEGKLPLGNATQVRHLSELLNMSDVVSLHVPETPSTRNMIGAAELARMKPGAILINAAR
GSVVDIDALCQSLESRHLSGAAIDVFPTEPATNSDPFTSPLCRFDNVLLTPHIGGSTQEA
QQNIGVEVAGKLAKYSDNGSTLSAVNFPQVSLPMHEDHVSRLLHTHENRPGMLNAINQIF
AEEGVNIAAQYLQTTPTIGYVVIDVETETERAEAALQRMREIPGTVRARLLY
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagtttctttggacaaggatagaatcaagtttttgctggtggagggggtgcat
caaagcgccgtcgatacgttgcgcgccgccggttataacaacattgaataccataagggg
gcgctggatgacgatgcgctgcgcgaggcgatccgcgacgcccactttatcggcctgcgc
tcgcgcacgcagctgagcgaggcgatgtttgccgcggcggaaaagctggtggcggtgggc
tgcttttgtatcggcaccaaccaggtcgatctggctgcggcgcagcgccgcggcgttccg
gtgttcaatgcgccgttctccaacacccgctcggtggcggagatggtgctgggggagacc
ctgctgctgctgcgcaatatcccgcaggctaacgcgtgcgctcaccgcggtgagtggagc
aagcaggcggtgggctgttatgaggcgcgcggcaagaagctggggatcatcggctatggc
cacatcggcacgcagctggggattctggcggaagggatcgggatggacgtctatttttat
gacatcgagggcaagctgccgctgggcaacgcgactcaggtgcgccatctctccgagctg
ctgaacatgagcgacgtggtctcgctgcatgtgccggagacgccctccacccgtaatatg
attggcgcggcggagctggcgcgaatgaagcccggcgcgattctgatcaacgccgcgcgc
ggttcggtggtggatatcgatgccctgtgtcagtctctggaaagccgtcacctgagcggt
gcggcgatcgatgtctttccgacggagccggcgaccaacagcgaccccttcacctcgccg
ctgtgccgctttgacaacgtcctgctgacgccgcacatcggcggttcgacccaggaggcc
cagcagaatatcggcgttgaggtggcaggcaagctggcgaagtactccgacaacggctcg
accctgtcggcggtgaactttccgcaggtctccctgccgatgcatgaggatcacgttagc
cgtctgctgcatacccatgaaaaccgcccggggatgctgaatgctatcaaccagattttt
gccgaagagggggtgaatatcgccgctcagtacctgcagaccaccccgaccatcggctat
gtggtgatcgacgtggagacggagaccgagcgggcggaggcggcgctgcagcgcatgcgc
gagatccccggcaccgtgcgtgctcgcctgctgtactaa

DBGET integrated database retrieval system