KEGG   Edwardsiella piscicida C07-087: ETAC_14225Help
Entry
ETAC_14225        CDS       T02509                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00030  Pentose phosphate pathway
etc00051  Fructose and mannose metabolism
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
etc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_14225
   00030 Pentose phosphate pathway
    ETAC_14225
   00051 Fructose and mannose metabolism
    ETAC_14225
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_14225
Enzymes [BR:etc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     ETAC_14225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase Ntox22
Motif
Other DBs
NCBI-ProteinID: AGH74966
Position
complement(3209541..3210617)
Genome map
AA seq 358 aa AA seqDB search
MSKIFDFVKPGVIFGDDVQKVFQVAKENKFALPAVNCVGTDSVNAVMEAAAKVRAPIIVQ
FSNGGAAFIAGKGLKLEGQQAAILGAISGAHHVHQMAEYYGVPVILHTDHCAKKLLPWLD
GLLDAGEKHFAATGKPLFSSHMIDLSEESLEENIEICSQYLARMSKIGMTLELELGCTGG
EEDGVDNSHLDNSALYTQPEDVDYAFTKLSAISPRFTIAASFGNVHGVYKPGNVQLTPVI
LKNSQEYVSKKHNLPHNSLNFVFHGGSGSTAAEIKEAVSYGVVKMNIDTDTQWATWEGVL
KYYKKNEGYLQGQLGNPEGDDKPNKKYYDPRVWLRAGQTGMIERLELAFKELNCIDVL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaatctttgactttgttaaaccgggtgtcatctttggcgatgacgttcagaaa
gtattccaggtagcgaaagagaacaaattcgctctgccggccgttaactgcgtcggtacg
gactccgtcaacgctgtgatggaggccgccgccaaggtacgcgctccgatcatcgttcag
ttctccaacggcggcgctgccttcatcgccggcaaagggctgaagctggagggccagcag
gcggctatcctcggcgcgatctccggtgcgcaccacgtgcatcagatggccgaatactac
ggtgttccggtgatcctgcacaccgaccactgcgccaagaagctgctgccgtggctggac
gggctgctggacgccggtgagaagcacttcgccgcgaccggcaagccgctgttctcctcc
cacatgatcgacctctccgaggagtctctggaagagaacatcgaaatctgctctcagtac
ctggcccgcatgtccaagatcggcatgaccctggagctggagctgggctgcaccggcggt
gaagaagacggcgtggacaacagccacctggacaactccgcgctgtacacccagccggaa
gacgtggattacgcgttcaccaagctgagcgccatcagcccgcgtttcaccatcgccgcc
tccttcggcaacgtgcacggcgtgtacaagccgggtaacgtgcagctgacgccggtgatc
ctgaaaaactctcaggaatacgtttctaagaaacacaacctgccgcataacagcctgaac
tttgtcttccacggcggctccggctctaccgcggcagagatcaaagaagcggtcagctac
ggcgtggtgaagatgaacatcgacaccgatacccagtgggcaacctgggaaggcgtgctg
aagtactacaagaagaacgaaggctatctgcagggccagctgggtaacccggaaggcgac
gacaagccgaacaagaaatactacgatccgcgcgtatggctgcgcgccggtcagaccggg
atgatcgagcgcctggagctggcattcaaagagctgaactgcatcgacgtgctgtaa

DBGET integrated database retrieval system