KEGG   Edwardsiella piscicida C07-087: ETAC_14230Help
Entry
ETAC_14230        CDS       T02509                                 

Gene name
pgk
Definition
(GenBank) phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
etc_M00002  Glycolysis, core module involving three-carbon compounds
etc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_14230 (pgk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_14230 (pgk)
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     ETAC_14230 (pgk)
Exosome [BR:etc04147]
 Exosomal proteins
  Proteins found in most exosomes
   ETAC_14230 (pgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK
Motif
Other DBs
NCBI-ProteinID: AGH74967
Position
complement(3210726..3211889)
Genome map
AA seq 387 aa AA seqDB search
MSVIKMTDLDLAGKRVLIRADLNVPVKDGKVTSDARIRASLPTIELALKQGARVMVTSHL
GRPTEGEYNDAFSLLPVVNYLKDHLKSPVRLAKDYLDGVDVAQGELVVLENVRFNKGEKK
DDETLSKKYAALCDVFVMDAFGTAHRAQASTHGVGKFAPIACAGPLLSGELEALGKALSN
PARPMVAIVGGSKVSTKLTVLDSLSKIADQLIVGGGIANTFIAAEGHNVGKSLYEADLIP
EAKKLLGTCDIPVPTDVRVATEFSETAPATMKSVSDIKDDEQVLDLGDASAEQLAAILKN
AKTILWNGPVGVFEFPNFRKGTEIVANAIANSDAFSIAGGGDTLAAIDLFGIADKISYIS
TGGGAFLEFVEGKKLPAVVMLEERAKQ
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaattaagatgaccgatttggatctggcgggtaaacgcgttctgatccgtgcg
gacctgaacgttccggttaaagacggtaaagtgacttccgatgcgcgtatccgcgcgtcg
ctgccgaccattgagctggcgctgaagcagggtgcgcgcgtgatggtaacctcccatctg
ggtcgtccgaccgaaggcgagtacaacgatgcgttctctctgctgccggtggtgaattac
ctcaaagatcatctgaagtcgccggtgcgtctggccaaagattacctggacggcgttgac
gttgcccagggcgagctggtggtgctggaaaacgtccgcttcaacaagggcgagaagaaa
gacgacgaaaccctgtctaagaaatacgctgccctgtgcgacgtgttcgttatggatgcg
ttcggcaccgcgcaccgcgcccaggcctctacccacggcgtgggcaagtttgcgccgatc
gcctgtgccggtccgctgctgtccggcgagctggaagccctgggcaaagccctgagcaac
ccggcgcgtccgatggtcgccatcgtcggcggctccaaagtctccaccaagctgaccgtt
ctggactccctgtccaagatcgctgaccagctgatcgtgggcggcggtatcgcgaatacc
ttcatcgcggcggaaggccacaacgtgggtaaatccctgtatgaagccgacctgatcccg
gaagccaagaagctgctgggcacctgcgatatcccggtaccgaccgacgtgcgcgtagcc
accgagttctctgagacggcgccggcgaccatgaagtccgtcagcgacatcaaagacgac
gagcaggttctggatctgggcgatgcctctgccgagcagctggccgctatcctgaaaaac
gccaagaccatcctgtggaatggtccggtcggcgtcttcgagttcccgaacttccgtaaa
gggaccgagatcgtggccaatgccatcgccaacagcgacgccttctccatcgccggcggc
ggcgatacgctggcggccatcgatctgttcggcatcgccgataagatctcctacatctcc
accggcggcggcgccttcctggagtttgtagaaggcaagaaactgccggctgtggtgatg
ctcgaagagcgcgccaagcagtaa

DBGET integrated database retrieval system