KEGG   Edwardsiella piscicida C07-087: ETAC_14240Help
Entry
ETAC_14240        CDS       T02509                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00030  Pentose phosphate pathway
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
etc_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ETAC_14240
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    ETAC_14240
Enzymes [BR:etc01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     ETAC_14240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AGH74969
Position
complement(3213297..3215291)
Genome map
AA seq 664 aa AA seqDB search
MSSRKELANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWRDYMNHNPVNPHWADRDRF
VLSNGHGSMLIYSLLHLTGYDLPMSELENFRQLHSKTPGHPEYGYTPGVETTTGPLGQGI
ANAVGMAIAERTLGAQFNRPGHEIVDHYTYAFMGDGCMMEGISHEVCSLAGTLKLGKLIA
FYDDNGISIDGHVDGWFTDDTAKRFEAYGWHVVRGVDGHDSAAIKAAIEEARSVSDKPSL
LMCKTVIGFGSPNKAGTHDSHGAPLGDAEIAATRAQLGWNYPPFVIPQEIYAEWDAKEAG
KAKEQAWDARFAAYQAAFPQLAAEFKRRINGELPASWDSESRQFIEQLQANPAKIASRKA
SQNALEAFGKLLPEFLGGSADLAPSNLTMWSGSKALNEDAAGNYIHYGVREFGMTAIING
IALHGGFIPYGATFLMFMEYARNAMRMAALMKIRNIQVYTHDSIGLGEDGPTHQPVEQMA
SLRTTPNMNTWRPCDQVESAVAWKKAIERLDGPSALIFSRQNLTQMDRSAEQLANVERGA
YVLQDCAGQPELIFIATGSEVELAMNAAAKLSAEGRQVRVVSMPSTEVFDKQDAAYREAV
LPSAVSARVAVEAGIADFWFKYVGLNGAVVGMTSFGESAPAEQLFVEFGFTVDNVLAKAR
ALLK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctcgtaaagagcttgccaatgctatccgtgccctgagcatggatgcggtgcag
aaggccaaatccggtcacccgggcgccccgatggggatggcggatatcgccgaagtcctg
tggcgtgattacatgaaccataacccggtcaacccgcactgggccgatcgcgaccgtttt
gtgctgtccaacggccatggttccatgctgatttatagcctgctgcaccttaccggctat
gatcttccgatgtctgagctggaaaacttccgccagctgcactccaagaccccgggtcac
ccggagtatggctataccccgggcgttgagaccaccaccggtccgctgggccagggcatt
gccaacgccgtcggcatggccatcgccgagcgcacgctgggcgcgcagttcaaccgcccg
ggccacgagatcgtcgaccactacacctacgcttttatgggcgacggctgcatgatggaa
ggcatctctcacgaggtctgctccctggccggtaccctgaagctgggcaaactgatcgcg
ttttacgatgacaacggtatctccatcgacggtcacgttgacggctggttcaccgatgat
accgccaagcgttttgaagcctacggctggcacgtggtgcgcggcgtagacggtcacgac
agcgccgccatcaaggccgctatcgaagaggcgcgcagcgttagcgacaagccgtccctg
ctgatgtgcaaaaccgtcatcggcttcggctcgccgaacaaggccggtacccatgactcc
cacggcgcgccgctgggcgatgccgagatcgcggccacccgcgctcagctgggctggaac
tacccgccgttcgtcatcccgcaggaaatctacgccgagtgggatgccaaagaggccggt
aaggccaaagagcaggcctgggatgcccgtttcgccgcctatcaggccgcgttcccgcag
ctggccgccgagttcaaacgccgtatcaacggcgaactgccggccagctgggacagcgaa
tctcgccagtttatcgaacagctgcaggccaacccggccaagatcgctagccgtaaggcg
tcgcagaatgcgctggaagcctttggcaagctgctgccggagttcctgggcggctccgcc
gacctggcgccgagcaacctgaccatgtggtccggctccaaggcgctgaacgaagacgcc
gcgggcaactacatccactacggcgtgcgcgagttcggcatgaccgccatcatcaacggc
atcgcgctgcacggtgggtttatcccctacggtgcgaccttcctgatgttcatggagtat
gcccgtaacgccatgcgtatggctgccctgatgaagatccgtaacattcaggtctacacc
catgactctatcggtctgggcgaagacggcccgacccatcagccggtcgagcagatggcc
agcctgcgcaccacgccgaacatgaacacctggcgtccgtgtgaccaggtggagtccgcc
gttgcctggaagaaagccatcgagcgtctggacggcccgtcagcgctgatcttctcccgt
cagaacctgacccagatggatcgcagcgccgagcagctggccaacgttgaacgcggcgcc
tacgttctgcaggactgcgccggtcagccggagctgatcttcattgccaccggttccgaa
gtggagctggcgatgaacgccgcggccaagctgagcgccgaagggcgtcaggtgcgcgtc
gtctccatgccgtcgaccgaagtgttcgacaagcaggacgccgcctaccgtgaagccgtg
ctgccgtctgccgtcagcgcccgcgtggcggtggaggccggtatcgccgacttctggttc
aagtacgtcggcctgaacggcgccgtcgtcggcatgacctccttcggtgagtccgcgccg
gccgagcagctgttcgtcgagttcggctttaccgtcgacaacgtgctggccaaggcccgc
gcgctgctgaagtaa

DBGET integrated database retrieval system