KEGG   Edwardsiella piscicida C07-087: ETAC_14435Help
Entry
ETAC_14435        CDS       T02509                                 

Definition
(GenBank) hydrogenase 1 b-type cytochrome subunit
  KO
K03620  Ni/Fe-hydrogenase 1 B-type cytochrome subunit
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_14435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ni_hydr_CYTB DUF4405
Motif
Other DBs
NCBI-ProteinID: AGH75008
Position
complement(3254684..3255418)
Genome map
AA seq 244 aa AA seqDB search
MSEKTSPRAEEARDDAVSHYVFEAPVRLWHWLTVGCMLVLMVTGYFIGRPLPSVSGEATY
LFYMGYIRLVHFSAGMLFTVLLLMRIYWACVGNRYSRELFVVPVWRRSWWQGVLYEIRWY
LFLEKRPSGDIGHNPIAQAAMFGYFLMSVFMILTGFALFSEHSQYAIFAPFHYVIEFFYW
TGGNSIDIHSWHRLGMWLIGAFIIGHVYMAIREDIMSDDTVISTMINGFRSHKFPKRKRD
KEAS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaagacatccccgcgcgccgaggaggcgcgtgatgatgccgtcagccactat
gtgttcgaggcgccggtgcgcctgtggcactggctgacggtgggctgcatgctggtgctg
atggtgaccgggtacttcattggccggccactgccgtcggtcagcggcgaggccacctat
ctgttctacatgggctatatccgtctggttcatttcagcgcagggatgctgttcaccgtg
ctgttgctgatgcgcatctattgggcctgcgtcggcaaccgctactcgcgcgagctgttc
gtggtgccggtgtggcgccgcagctggtggcagggcgttttgtatgagatccgctggtat
ctgtttctggagaagcgcccgagcggtgacattggccataaccccatcgcccaggcggcg
atgtttggctatttcctgatgtcggtattcatgatcctcaccgggttcgcgctgttcagc
gagcatagccagtacgccatcttcgccccgttccactatgtgatcgagttcttctactgg
accggcggcaactctatcgatatccacagctggcaccgcctggggatgtggcttatcggg
gcatttatcattgggcatgtgtatatggccatccgcgaggacatcatgtctgacgacacg
gttatctctaccatgatcaatggattccgcagtcataagttcccgaagcgtaaacgcgac
aaggaggcgtcatga

DBGET integrated database retrieval system