KEGG   Edwardsiella piscicida C07-087: ETAC_14560Help
Entry
ETAC_14560        CDS       T02509                                 

Definition
(GenBank) beta-D-glucuronidase
  KO
K01195  beta-glucuronidase [EC:3.2.1.31]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00040  Pentose and glucuronate interconversions
etc00860  Porphyrin and chlorophyll metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ETAC_14560
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ETAC_14560
Enzymes [BR:etc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     ETAC_14560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2 Glyco_hydro_cc
Motif
Other DBs
NCBI-ProteinID: AGH75033
Position
complement(3285888..3287699)
Genome map
AA seq 603 aa AA seqDB search
MLKPIESRSRERKNLSGLWQFVPDVQRCGHREQWWCGPLPGARTIAVPASFNDQFADDAI
RNHVGDVWYQTAVRVPRGWDGQRVVLRFDAVTHGATVWVDETQVMTHQGGYTPFEADISA
LLAGREQVRVTVCVNNELSWHTIPPGRVTEVNGERRLQYSYDFFNYAGIHRPVWLYSTPQ
DYVRDVHVTTEISAEGGAGLVHYAVDAGDASVHCRLLDDRQNCVAESEGARGTLTVANPC
LWQPGEGYLYTLQVCAGEGIDEYTLRVGIRTVEVTESAFLINGKPFYFTGFGRHEDADLR
GRGLDPVLLVHDHALMRWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETPAVGMMALNG
FTLDLSSREEKLFCEERIGSQTQRAHLQAIRELIARDKNHPSVVMWSLANEPDVREVAAR
DYFAPLVQAARELDPSRPLCCVNIMLCPPDKDTISDLFDVLCLNRYFGWYVNSGDLATAG
RELEQELSVWHARHRKPIIITEYGADTLAGLHSVYPEMWSEEFQAQFLTTYHRVFDRLPY
VVGEQVWNFADFATAQGILRAGGNKKGVFTRDRKPKAAAFTLKARWTAVQYGVKPAGDKG
DVQ
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagccgattgaaagccgttcccgtgagcgtaagaacctgagcgggctgtggcag
tttgtgccggatgtacagcgttgtggtcaccgcgaacagtggtggtgtgggcctttgccg
ggcgcccgaaccattgcggtccccgccagttttaacgatcagtttgccgatgatgccatc
cgtaaccacgtgggggatgtgtggtatcagaccgcggtgcgtgtgccgcgcggctgggac
gggcagcgggtggtgctgcgctttgacgcagtaacccatggggcgacggtgtgggtggat
gaaacccaggtcatgacgcatcaggggggatataccccgtttgaggcggacatcagcgct
ctgctggccgggcgtgagcaggtgcgcgtcaccgtctgcgtcaataatgaactctcctgg
cacaccatcccgccggggagggtcaccgaggtcaacggtgagcgccgcctgcagtatagc
tatgatttctttaactatgccgggatccatcgcccggtgtggctctattcaacgccgcag
gattatgtccgtgatgtccacgtaacgaccgaaatcagcgccgaggggggagcggggctg
gtgcactatgcggttgatgccggcgatgccagcgtgcattgccgcctgctggatgatcgg
cagaactgtgtggccgagagcgagggggcgagggggacgctgacggtcgccaatccatgt
ctatggcagccgggggagggctatctgtataccctgcaggtatgcgccggggaggggatc
gatgaatacactctgcgggtggggatccgcaccgtggaggtcacggagagcgccttcctg
atcaatggcaagccgttctactttaccggttttggccgtcatgaggatgcggatctgcgc
ggcagagggctggatcctgtgctgctggtgcacgatcacgccctgatgcgctggatcggc
gccaactcgtatcgcacctcccactacccctatgccgaggagatgctggactgggccgat
gagcacggcatcgtggtgatcgatgagacgccggcggtggggatgatggccctgaacggc
ttcacgctggatctctcctctcgggaggagaaactgttttgtgaggagcgcatcggttct
cagacccagcgggcccacctgcaggcgatccgcgagcttatcgcccgcgataaaaaccac
cccagcgtggtgatgtggagcctggcgaacgaacccgatgtccgcgaggtggcggcgcgc
gactactttgctcccttggtacaggcggcacgggagctggatccctcccgtccgctgtgc
tgcgtcaacattatgctctgcccgccggacaaggacaccatcagcgatctgtttgacgtg
ctgtgtctgaaccgttatttcggctggtatgtcaacagcggcgatctggctaccgccggg
cgtgagctggagcaggagctgtcggtatggcatgcgcggcaccgcaagccgatcatcatt
acggaatatggggccgataccctggcggggctgcacagcgtgtatccggagatgtggagc
gaggagtttcaggcacagtttttaaccacctatcaccgggtatttgatcgtctgccctac
gtggtgggggaacaggtgtggaacttcgccgatttcgcgacggcgcaggggatcctgcgc
gccggcggcaataagaaaggggtgtttacccgcgacagaaagcccaaggcggcggctttt
accctcaaggcgcgctggacggcggtgcaatacggggtgaaacccgccggtgacaagggg
gacgtgcaatga

DBGET integrated database retrieval system