KEGG   Edwardsiella piscicida C07-087: ETAC_14575Help
Entry
ETAC_14575        CDS       T02509                                 

Definition
(GenBank) phosphotransferase enzyme II, A component SgcA
  KO
K02821  PTS system, ascorbate-specific IIA component [EC:2.7.1.194]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00053  Ascorbate and aldarate metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc02060  Phosphotransferase system (PTS)
Module
etc_M00283  PTS system, ascorbate-specific II component
etc_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    ETAC_14575
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ETAC_14575
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_14575
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.194  protein-Npi-phosphohistidine---L-ascorbate phosphotransferase
     ETAC_14575
Transporters [BR:etc02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Ascorbate-specific II component [MD:M00283]
    ETAC_14575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_2
Motif
Other DBs
NCBI-ProteinID: AGH75036
Position
3291199..3291642
Genome map
AA seq 147 aa AA seqDB search
MLTTLLTPDVIQVVERAENWRDAIHIACAPLIHNQSIAPRYIDAIIQSHEKIGPYYVLGP
GMAMPHARPEDGVNRLSLGLTVIKQGVEFGSEGNDPIKLLIVLAATDSNSHIGVIAKLAE
LFDNQDDIDRILQSENADDILSIIARY
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgttgacgacgctgcttacccccgacgttattcaggtggttgaacgagccgagaactgg
cgtgatgcgatccatatcgcctgcgcgccgctgatccacaaccaatcgatcgccccccgc
tatatcgacgccataattcagtcccacgaaaaaatcggcccctattatgttctggggcca
ggcatggcgatgccccacgcccgccccgaagacggcgttaaccgcctctcgctggggctg
acggtgatcaaacagggcgtggaattcggctctgagggtaacgacccgattaaattactg
attgtgctggcggccaccgacagcaacagccatatcggcgttatcgccaaactcgccgag
ctttttgataaccaagacgatatcgacagaattctgcagtcagaaaacgcagatgacatt
ctcagcatcattgctcgttattaa

KEGG   Edwardsiella piscicida C07-087: ETAC_14580Help
Entry
ETAC_14580        CDS       T02509                                 

Definition
(GenBank) Putative sugar phosphotransferase component II B
  KO
K02822  PTS system, ascorbate-specific IIB component [EC:2.7.1.194]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00053  Ascorbate and aldarate metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc02060  Phosphotransferase system (PTS)
Module
etc_M00283  PTS system, ascorbate-specific II component
etc_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    ETAC_14580
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ETAC_14580
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_14580
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.194  protein-Npi-phosphohistidine---L-ascorbate phosphotransferase
     ETAC_14580
Transporters [BR:etc02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Ascorbate-specific II component [MD:M00283]
    ETAC_14580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_IIB
Motif
Other DBs
NCBI-ProteinID: AGH75037
Position
3291668..3291955
Genome map
AA seq 95 aa AA seqDB search
MNITVVCGNGLGTSLMMEMSIKTILKDLQVNAEVNHVDLGSAKGTASDIFVGTADIAEQL
VAQQVGGEIVALDNMIDKVAMKERLSVALRKLGAL
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgaatattacagttgtatgcggaaacggtttaggcaccagcctgatgatggaaatgagc
atcaaaaccattcttaaagatctgcaggtcaacgccgaggttaaccacgttgacttaggc
tccgccaaaggcaccgccagcgatatctttgtcggcaccgccgatattgccgagcagctg
gtcgcccagcaggtcggcggcgagatcgtcgcgctggataatatgatcgacaaagtggcg
atgaaagagcgtctgagcgtcgcactgcgtaaactcggcgcactctag

KEGG   Edwardsiella piscicida C07-087: ETAC_14585Help
Entry
ETAC_14585        CDS       T02509                                 

Definition
(GenBank) Putative integral membrane protein
  KO
K03475  PTS system, ascorbate-specific IIC component
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00053  Ascorbate and aldarate metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc02060  Phosphotransferase system (PTS)
Module
etc_M00283  PTS system, ascorbate-specific II component
etc_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    ETAC_14585
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ETAC_14585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_14585
Transporters [BR:etc02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Ascorbate-specific II component [MD:M00283]
    ETAC_14585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIC-GAT
Motif
Other DBs
NCBI-ProteinID: AGH75038
Position
3291966..3293222
Genome map
AA seq 418 aa AA seqDB search
MSFFRFLMQDVLSEPAILVGLIALIGLIAQKKPVTECIKGTIKTIMGFVILGAGAGLVVS
SLGDFSAIFQHAFGINGVVPNNEAIVSIAQKSFGREMAMIMFFAMLINIVIARLTPWKFI
FLTGHHTLFMSMMVAVILATAGMQGTMLVLVGSLIVGFCMVFFPAIAHPYMKKITGSDDV
AIGHFSTVSYVLAGFIGSKFGNKEHSTEDMNVPKSLLFLRDTPVAISFTMFIIFIITCLF
AGGDYVREVSGGKNWFMFSLMQSITFAAGVYIILQGVRMVIAEIVPAFKGISDKLVPNAK
PALDCPVVFPYAPNAVLVGFLSSFAAGVIGMFILYALHMTVIIPGVVPHFFVGAAAGVFG
NATGGRRGAILGAFAQGLLITFLPVFLLPVLGQIGIANTTFSDADFGVIGILLGIIVR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcattctttcgttttctgatgcaggatgtgctctcagagccggcgatattggtcggc
ctgattgcgcttatcggccttatcgcgcagaaaaaaccggtcaccgaatgtattaaaggc
accatcaaaaccattatgggttttgttattctgggcgccggtgccggcctggtggtcagt
tcgctgggcgatttctcggctattttccagcacgccttcggtattaacggcgtcgtgccg
aataacgaggccatcgtttccattgcacaaaagagctttggccgtgaaatggcgatgatc
atgttcttcgccatgctgatcaatatcgtcatcgcccgcctgacgccgtggaaatttatc
ttcctgaccggccaccacacgctgtttatgtcgatgatggtggcggtgatcttggccacc
gccgggatgcagggaacgatgctggtgctggtcggctcgctgatcgtcggtttctgcatg
gtgttcttcccggccatcgcccacccctatatgaaaaagatcaccggctcggacgacgtg
gctatcggccatttctcgacggtatcctacgttctggccggctttatcggcagcaagttc
ggcaataaagagcattcaaccgaagacatgaatgtgccgaagagcctgctgttcctgcgc
gacacgccggtggctatctcatttaccatgttcatcatcttcatcatcacctgcctgttc
gccggcggtgactatgtacgcgaggtgagcggcggtaaaaactggtttatgttctcgctg
atgcagtccatcaccttcgccgccggggtctacatcatcctgcagggcgtgcggatggtt
atcgccgagatcgtcccggcgtttaaggggatctccgacaaactggtgcccaacgccaag
ccggcgctggattgcccggtcgtgttcccctacgctcccaacgcggtgctagtcggcttt
ctcagcagcttcgccgccggggtcatcggcatgttcatactctacgcgctgcacatgacg
gtgatcatccccggcgtggtgccccacttcttcgtcggcgcggcggccggtgtattcggc
aacgccaccggcgggcggcgcggtgccatcctgggcgccttcgctcaggggctgctgatc
accttcctgccggtgtttctgctgccggtgctcggccagatcggcatcgccaacaccacc
ttcagcgacgccgacttcggcgtgatcggcattttactgggcattatcgtgcgctga

KEGG   Edwardsiella piscicida C07-087: ETAC_15700Help
Entry
ETAC_15700        CDS       T02509                                 

Gene name
ulaA
Definition
(GenBank) PTS system ascorbate-specific transporter subunit IIC
  KO
K03475  PTS system, ascorbate-specific IIC component
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00053  Ascorbate and aldarate metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc02060  Phosphotransferase system (PTS)
Module
etc_M00283  PTS system, ascorbate-specific II component
etc_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    ETAC_15700 (ulaA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ETAC_15700 (ulaA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_15700 (ulaA)
Transporters [BR:etc02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Ascorbate-specific II component [MD:M00283]
    ETAC_15700 (ulaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIC-GAT CcmH
Motif
Other DBs
NCBI-ProteinID: AGH75261
Position
3543113..3544510
Genome map
AA seq 465 aa AA seqDB search
MDILYRAFLIFFNQVMTNAPLLLGIVTCLGYLLLRKPATVIIKGTIKTIIGFMLLQAGSG
ILTSTFKPVVAKMSKVYHINGAISDTYASMMATIERMGDAYSWVGYTVLLALALNILYVL
LRRLTGIRTIMLTGHIMFQQAGLIAVVFYIFGYPMWTTILCSALLVSLYWGITANMMYRP
TQEVTDGCGFSIGHQQQFASWLAYRLAPYLGRREESVEDLKLPGWLNIFHDNIVSTAIVM
TLFFGLILCSFGLDTVQLMAGKTHWSIYILQTGFQFAVAIFIIVQGVRMFVAELSEAFTG
ISQRLIPGAVLAIDCAAIYSFAPNAVVWGFIWGTIGQLIAIGILILLGSPILIIPGFIPM
FFSNATIGVFANHFGGWRAAIKICLVMGMIEIFGCVWAVKLTGLSAWMGMADWSILAPPM
IQGLTLGLWFMGVLLLIALAYMLVAGRSLRAEEAAQADQARGATL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggacattctgtaccgtgcctttctgatttttttcaatcaggtgatgaccaacgccccc
ctgctgctggggattgtcacctgtctcggctacctgctgctgcgtaaaccggcgacggtg
atcatcaaaggcaccatcaaaaccatcatcggctttatgctgctgcaggcgggctccggc
atcctgacctcaaccttcaaaccggtggtagccaagatgtccaaggtctatcacatcaac
ggagccatttcagatacctacgcctcgatgatggccaccatcgagcgcatgggtgacgcc
tacagctgggtaggctataccgtgctgctagcgctggcgctgaacattctctacgtcctg
ctgcgccgcctcaccggcatccgcaccatcatgctgaccggccacatcatgtttcagcaa
gccgggcttatcgccgtggtgttctatatcttcggctatcccatgtggaccacgatcctg
tgcagcgcgctgctggtctcactctactggggcatcaccgccaacatgatgtatcgcccc
acccaggaggtcaccgacggctgcggcttctccattggccatcagcagcagtttgcctcc
tggctggcctatcggctggccccctatctggggcgcagggaggagagcgttgaagacctc
aagctgcccggctggctgaatatcttccacgacaatatcgtctcgaccgcgatcgtgatg
accctgttcttcgggctgatcctctgctctttcgggctggacaccgtccagctgatggcg
gggaaaacccactggagcatttacatcctgcagaccggttttcagttcgccgtcgcaatc
ttcatcatcgtccagggggtgcgcatgttcgtcgcggagctgtcagaggccttcaccggc
atctctcagcgcctgatccccggcgccgtgctggccatcgactgcgcggccatctacagc
tttgcccccaacgccgtcgtgtgggggtttatctggggcaccatcgggcagctgatcgcc
atcggcatcctgatcctgctggggtcacctatcctgatcatccccggctttatccccatg
ttcttctccaacgcgacgatcggcgtctttgccaaccacttcggcggctggcgagcggcc
atcaagatttgtctggtcatggggatgattgaaatcttcggctgcgtctgggccgtcaag
cttaccgggctcagcgcctggatggggatggccgactggtccatcctggccccgccgatg
atccaggggctgacgctgggcctatggttcatgggcgttctgctgctgatcgccctggcc
tacatgctggttgccgggcgcagcctgcgcgcggaagaggcggcgcaggccgatcaggcg
cgcggcgcaacactctaa

KEGG   Edwardsiella piscicida C07-087: ETAC_15705Help
Entry
ETAC_15705        CDS       T02509                                 

Definition
(GenBank) PTS system L-ascorbate-specific transporter subunit IIB
  KO
K02822  PTS system, ascorbate-specific IIB component [EC:2.7.1.194]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00053  Ascorbate and aldarate metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc02060  Phosphotransferase system (PTS)
Module
etc_M00283  PTS system, ascorbate-specific II component
etc_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    ETAC_15705
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ETAC_15705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_15705
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.194  protein-Npi-phosphohistidine---L-ascorbate phosphotransferase
     ETAC_15705
Transporters [BR:etc02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Ascorbate-specific II component [MD:M00283]
    ETAC_15705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_IIB
Motif
Other DBs
NCBI-ProteinID: AGH75262
Position
3544528..3544833
Genome map
AA seq 101 aa AA seqDB search
MTVRILAVCGNGQGSSMIMKMKVDQFLTQQGVDHSVNSCAVGEYKSELSGVDIIIASTHV
AGEISVSGNKYVVGVRNMLSAEEFGPRLMEVIRAHFPQDLS
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgacagtacgcattctcgccgtctgcggtaacggccaaggcagttcaatgatcatgaag
atgaaggtggatcagtttctaacccagcagggcgttgaccacagcgtcaacagctgcgcg
gtcggcgagtataaatcggagctgagcggcgtagatatcatcattgcatccacccacgtc
gccggcgagatcagcgtcagcggcaataaatacgtggtcggggtacgcaatatgctgtcg
gcggaagagttcggccccaggctgatggaggtcatccgcgcccactttccccaggacctc
agctaa

KEGG   Edwardsiella piscicida C07-087: ETAC_15710Help
Entry
ETAC_15710        CDS       T02509                                 

Definition
(GenBank) PTS system L-ascorbate-specific transporter subunit IIA
  KO
K02821  PTS system, ascorbate-specific IIA component [EC:2.7.1.194]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00053  Ascorbate and aldarate metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc02060  Phosphotransferase system (PTS)
Module
etc_M00283  PTS system, ascorbate-specific II component
etc_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    ETAC_15710
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ETAC_15710
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_15710
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.194  protein-Npi-phosphohistidine---L-ascorbate phosphotransferase
     ETAC_15710
Transporters [BR:etc02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Ascorbate-specific II component [MD:M00283]
    ETAC_15710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_2
Motif
Other DBs
NCBI-ProteinID: AGH75263
Position
3544840..3545328
Genome map
AA seq 162 aa AA seqDB search
MMKLRDSLAENHSIRLQAEAADWPAAVRIGVDLLVDAGVVEPRYYRAILDSVARFGPYFV
LAPGLAMPHGRPEEGVIKTGFALVTLRTPVTFGHEDNDPVDILITLAAVDAHTHQEVGIR
QIVDLFEDEANFARLRACRTPAQVLALIDTATTPSHPQGVAS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaactgcgagactcgctggcggaaaaccacagcattcgcctacaggccgaggcg
gcggactggcctgcggccgtcaggatcggcgtagatctcctggtcgacgccggcgtcgtg
gagccacgctactaccgggccatcctggatagcgttgcgcgctttggcccctactttgtg
ctggcgccggggctggccatgccgcacgggcgcccggaagagggggtgatcaagaccggc
tttgcgctggtcaccctgcggacgccggtcacgttcggccatgaggataacgacccggtg
gacattctgatcaccctggccgccgtcgacgcccacacccatcaggaggtcggcatccgt
cagatcgtcgatctgttcgaggatgaggccaactttgcgcgtctgcgcgcctgccgcacg
ccagcgcaggtgctcgcgctcatcgatacggcaacaaccccatcgcatccccaaggagtc
gcctcatga

DBGET integrated database retrieval system