KEGG   Edwardsiella piscicida C07-087: ETAC_14645Help
Entry
ETAC_14645        CDS       T02509                                 

Definition
(GenBank) PTS system, diacetylchitobiose-specific IIA component
  KO
K02759  PTS system, cellobiose-specific IIA component [EC:2.7.1.196 2.7.1.205]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00500  Starch and sucrose metabolism
etc02060  Phosphotransferase system (PTS)
Module
etc_M00275  PTS system, cellobiose-specific II component
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ETAC_14645
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ETAC_14645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_14645
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.196  protein-Npi-phosphohistidine---N,N'-diacetylchitobiose phosphotransferase
     ETAC_14645
    2.7.1.205  protein-Npi-phosphohistidine---cellobiose phosphotransferase
     ETAC_14645
Transporters [BR:etc02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component [MD:M00275]
    ETAC_14645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_IIA
Motif
Other DBs
NCBI-ProteinID: AGH75050
Position
complement(3309212..3309586)
Genome map
AA seq 124 aa AA seqDB search
MDKAESIILELLVNAGTARSLLMGALQQAREGNGSAVEQALAEAKQHIQCAHALQTQLIG
LDEGRGKFPVNLITVHAQDHLMDAMVIQDLAVHLVALYARHAVRASSGASGAGERGSASC
DKGG
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggataaggctgaaagcataatactggagctactggttaacgccggtacggcgcgcagt
ctgctgatgggggcgctacagcaggcgcgtgaggggaacgggagcgcggtcgagcaggcg
ctggcggaggccaagcagcatattcaatgcgcccacgcgctgcagacccagctgatcggt
ctggatgaagggcgcggtaaattccccgtgaacttaatcaccgtacatgcccaggatcat
ctgatggatgccatggtaatacaggatttagcggtacatctggtggcgctctatgcgcgt
cacgccgtgagggcgtcgagcggtgcgtcgggggcgggcgagagggggagcgcgtcctgc
gataaggggggataa

DBGET integrated database retrieval system