KEGG   Edwardsiella piscicida C07-087: ETAC_14765Help
Entry
ETAC_14765        CDS       T02509                                 

Definition
(GenBank) lipopolysaccharide ABC transporter permease LptF
  KO
K07091  lipopolysaccharide export system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00320  Lipopolysaccharide export system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_14765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_14765
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter [MD:M00320]
    ETAC_14765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LptF_LptG DDE_Tnp_1
Motif
Other DBs
NCBI-ProteinID: AGH75074
Position
complement(3338389..3339489)
Genome map
AA seq 366 aa AA seqDB search
MIIIRYLVRETFKSQVAILFILLLIFFCQKMVRILGAVVNGDIPTNLVFSLLGLGIPEMA
QLILPLSLFLGLLMTLGRLYTESEITVMHACGLSKAVLVKAAMALAFITGALALVNAFWL
SPWSSLHSDEVMAEARANPGLASLAEGQFQPSQDGNYVLFVGNVKDKKFHNVFLAQLRPS
GSQRPSVVVADSGHLVEMKDGAQKVVLDSGTRYEGTAMLRDFRITDFVDYSAIIGHKSAM
LDPNNADQASMSALWHSQEPSFRAEFHWRLTLVFSVIVMALMVVPLSVVNPRQGRVLSML
PAMLLYLIFFLLQSSLRSNGGKDKLDPMIWMWGVNGLYLLLAVVLNLWDTVPMRRLRARL
SGKGVA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgatcatcattagatatctagtacgggaaacctttaagagccaggtcgctatcctgttt
attctgctactgatctttttttgtcaaaagatggtgcgaattttaggggcggtggtgaac
ggtgatatcccgaccaatctggtattttccctgctcgggctgggaataccggagatggcc
cagctcattcttccgctcagcctgttcctggggctgctgatgacgctgggcagactgtac
acggagagcgagatcacggtgatgcacgcctgtggcctgagcaaggcggtgctggtgaag
gcggcgatggcgctggcctttattaccggcgcgctggcgctggtcaacgccttctggctg
agcccgtggtcctcgctgcactcggacgaggtgatggccgaggcgcgggctaaccccggc
ctggcgtcgctggcggaggggcagtttcagccctcgcaggacggcaactacgtgctgttt
gtcggcaatgtgaaggacaaaaaattccataatgtcttcctggcccagctgcgccccagc
ggctcccagcgcccgtcggtggtggtggccgacagcggtcatctggtggagatgaaggat
ggcgcgcagaaggtggtgctggacagcggtacccgctatgagggcaccgccatgctgcgc
gacttccgtatcaccgactttgtcgactattcggcgatcatcggccataaatcggcgatg
ctagaccccaataacgccgatcaggccagcatgtccgccctgtggcactcgcaggagccg
agcttccgcgccgagtttcactggcgcctgaccctggtgttctcggtgatcgtgatggcg
ctgatggtggtaccgctcagcgtggtcaacccgcgccaggggcgggtgctgtcgatgctg
ccggcgatgctgctgtaccttatcttcttcctgctgcagagctccctgcgctccaacggc
ggcaaggacaagctggacccgatgatctggatgtggggggtgaacggtctctacctgctg
ctggccgtcgtgcttaacctgtgggataccgtcccgatgcgccgcctgcgtgcgcgcctg
agcggaaaaggagtggcctga

DBGET integrated database retrieval system