KEGG   Edwardsiella piscicida C07-087: ETAC_14990Help
Entry
ETAC_14990        CDS       T02509                                 

Definition
(GenBank) 3-dehydroquinate dehydratase
  KO
K03786  3-dehydroquinate dehydratase II [EC:4.2.1.10]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETAC_14990
Enzymes [BR:etc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.10  3-dehydroquinate dehydratase
     ETAC_14990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHquinase_II
Motif
Other DBs
NCBI-ProteinID: AGH75119
Position
3395924..3396373
Genome map
AA seq 149 aa AA seqDB search
MADKFNILLLNGPNLNMLGVREPEKYGTLTLAQIVARLDRRAQTLGVSLRHIQSNAEHEL
IAQIHAAFGNTDFILINPAAFTHTSVALRDALLAVQIPFIEIHLSNVHAREPFRHHSYLS
DIAVGVICGLGAEGYDYALQAAVNRLNVS
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggcagataagttcaacattttgcttcttaacggtcccaatctgaatatgctgggcgtc
cgcgagccggaaaaatacggcaccctgacgctggcgcagattgtcgcgcgcctggatcgg
cgcgcgcagacgctcggcgtttcgctgcgccatattcagtccaatgcagagcatgagctg
atcgcccagatccatgccgcgtttggcaataccgattttattctgattaacccggcagcg
tttacccataccagcgtagcgctgcgcgatgccctgttggcggtgcagatcccgtttatc
gagatccatctgtccaacgtgcacgcccgagagccgttccgccaccactcctatctgtcc
gatatcgccgtgggggtcatttgcggtctgggcgccgaggggtatgactatgccctgcag
gcggcggttaatcgcctgaacgtatcatga

DBGET integrated database retrieval system