KEGG   Edwardsiella piscicida C07-087: ETAC_15120Help
Entry
ETAC_15120        CDS       T02509                                 

Definition
(GenBank) amino acid kinase
  KO
K00926  carbamate kinase [EC:2.7.2.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00220  Arginine biosynthesis
etc00230  Purine metabolism
etc00910  Nitrogen metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    ETAC_15120
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_15120
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    ETAC_15120
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.2  carbamate kinase
     ETAC_15120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase AlaDh_PNT_N SIS_2
Motif
Other DBs
NCBI-ProteinID: AGH75145
Position
complement(3425993..3426925)
Genome map
AA seq 310 aa AA seqDB search
MKKKIVLALGGNALGEGLAEQMKAVKTTARAIVDLIAQGHQVVVTHGNGPQVGMINQAFE
AAAKTEAHTPMLPMSVCVALSQGYIGYDLQNALREELRDRGMQTPVATLITQVEVDGNDP
AFLNPTKPIGSFFTQQEAELLTRNGYNMKEDAGRGYRRVVASPKPVDIIEKETVKAMINA
GQVVITVGGGGIPVIREGNHLRGASAVIDKDWASAKLAEMIDADMLIILTAVEKVAINFG
KPNQQWLDRLSLTDAQRFIDEGHFAKGSMLPKVEAALSFARTRPGREALITVLDKAKEGI
EGKTGTVVCQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaaatcgtgctcgcgctggggggaaacgcactgggcgaggggctggccgag
cagatgaaggcggtgaagaccacggcgcgggcgattgtcgatttgatagcgcaggggcac
caggtggtggtcacccacggtaacggtccgcaggtggggatgatcaaccaggcgtttgag
gcggcggcgaaaaccgaggcccatacgccgatgctgccgatgtcggtctgcgtcgcgctc
agtcaggggtacatcggctacgatctgcagaacgcgctgcgcgaggagctgcgggatcgc
ggcatgcagacgccggtggcgacgctgatcacccaggtggaggtcgatggaaacgatccg
gccttcctcaatccgaccaagccgatcggctccttctttacgcagcaggaggcggagctg
ctgacgcgcaatggctacaacatgaaagaggacgctgggcgcggctatcgccgcgttgtc
gcctcgccgaagccggtggacattattgagaaagagaccgttaaggcgatgatcaacgcc
ggccaggtggtgatcaccgtcggcggcggcgggatcccggtgatccgcgagggcaatcac
ctgcgcggcgccagcgcggtgatcgacaaggactgggccagcgccaagctggcggagatg
atcgacgccgacatgctgatcatcttgacggcggtggagaaggtcgccatcaactttggt
aagccgaaccagcagtggctcgatcgcctgagcctgacggacgcccagcgctttatcgat
gaggggcactttgccaagggctccatgctgccgaaggtggaggctgcgctctcctttgcg
cgcacccgtccggggcgcgaggcgctgatcaccgtactggataaagccaaagaggggatc
gaggggaaaaccggcaccgtggtgtgtcagtaa

DBGET integrated database retrieval system