KEGG   Edwardsiella piscicida C07-087: ETAC_15175Help
Entry
ETAC_15175        CDS       T02509                                 

Definition
(GenBank) aromatic amino acid aminotransferase
  KO
K00832  aromatic-amino-acid transaminase [EC:2.6.1.57]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00270  Cysteine and methionine metabolism
etc00350  Tyrosine metabolism
etc00360  Phenylalanine metabolism
etc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
etc00401  Novobiocin biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
etc_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ETAC_15175
   00350 Tyrosine metabolism
    ETAC_15175
   00360 Phenylalanine metabolism
    ETAC_15175
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETAC_15175
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    ETAC_15175
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:etc01007]
    ETAC_15175
Enzymes [BR:etc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.57  aromatic-amino-acid transaminase
     ETAC_15175
Amino acid related enzymes [BR:etc01007]
 Aminotransferase (transaminase)
  Class I
   ETAC_15175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGH75156
Position
complement(3439660..3440865)
Genome map
AA seq 401 aa AA seqDB search
MFEHVDDYAGDPILSLMESYQRDARAHKVNLSIGLYYDQRGEVPMLASVATALARLNAAA
PAAPLYLPMEGMADYRSAVQSLLLGDDHPALRARRVATIQTLGGSGALKVGADFLRRYFP
RAEVWVSDPTWENHIAIFEGAGFRVHRYPYFDPQTLGVCFDAMLATLEQLPPHSIVLLHP
CCHNPTGSDLTPAQWDSLVSLLRRRALIPFLDIAYQGFGGGMEQDAYAIRTMAAAGLPCL
VSNSFSKIFSLYGERVGGLSVMCSDEAEAGRVLGQLKATVRRNYSSPPLHGAALVAAVLN
DAALQRQWREEVEAMRLRIIAMRERLASHLNLALPSRRFDYLCQQRGMFSYTGLSAQQVG
DLRRRDGVYLVGSGRMCMAGLNEGNLDRVAAALVRVMASQE
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgaacatgtagatgactatgccggcgatccgatcctctccctgatggagagctat
cagcgggacgcccgcgcgcacaaagtgaatctgagcatcggcctgtactatgaccagcgg
ggcgaggtgccgatgctggcctctgtcgcgacggcgctggcccggctgaacgccgcggcg
ccggcggcaccgctctatctaccgatggaggggatggcagactaccgcagcgcggtgcag
tcgctgctgctgggggacgatcatcccgcgctgcgcgcgcggcgagtggcgaccatccag
accctggggggctcaggcgcgctcaaggtgggcgcggactttctgcggcgatattttccc
cgggccgaggtctgggtcagcgatccgacctgggagaatcatatcgcgattttcgagggc
gcagggttccgggtgcatcgctatccctattttgaccctcagacgctgggcgtctgcttc
gatgccatgctggcgacgctggaacagctgccgccccacagcatcgtgctgcttcacccc
tgctgtcataatcccaccggttcggatctgacgccggcgcagtgggatagtctggtgtcg
ctgctgcgacgtcgggcgctgatcccgtttctggatatcgcctatcaggggttcggcggc
ggcatggagcaggatgcctatgctatcaggacgatggccgccgcagggctgccctgcttg
gtcagcaactcgttctctaaaattttctcgctgtacggcgagcgcgtcggtggtctatcg
gtcatgtgcagcgatgaggccgaggccgggcgggtgctggggcaactgaaggcgacggtg
cggcgcaactactccagcccgccgctgcacggcgccgccttggtggccgccgtgctgaat
gacgccgcgttacagcgtcagtggcgcgaagaggtcgaggcgatgcgcctgcgcatcatc
gccatgcgcgagcggctggcgtcgcacctcaacctggcgctgccgtcgcgccgctttgac
tacctgtgtcagcagcgaggcatgttcagctataccggactcagtgcgcagcaggtcggc
gatctgcgccggcgcgatggcgtttacctggtcggcagcgggcgcatgtgcatggcggga
ctcaacgagggcaacctcgatcgcgtggccgccgcgctggttcgcgtcatggcgtcgcag
gaatag

DBGET integrated database retrieval system