KEGG   Edwardsiella piscicida C07-087: ETAC_15195Help
Entry
ETAC_15195        CDS       T02509                                 

Gene name
ampC
Definition
(GenBank) beta-lactamase/D-alanine carboxypeptidase
  KO
K01467  beta-lactamase class C [EC:3.5.2.6]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc01501  beta-Lactam resistance
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_15195 (ampC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ETAC_15195 (ampC)
Enzymes [BR:etc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     ETAC_15195 (ampC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AGH75160
Position
complement(3445501..3446661)
Genome map
AA seq 386 aa AA seqDB search
MMNTRLSCTLALSALLLSSGAQASTPPSAEMRVAEAVKQTIPALMQQQQIPGMAVAVIYQ
GTPYYFNYGVADKATRRAVTPQTLFELGSVSKTFTGVLGGYALQRGDIRLQDTVASQWPA
LNGPQWRAITLQQLATYTAGGLPLQVPDAVTDTAQLLDFYQRWQPRWAPGTMRSYSNASI
GLFGMLAVRPSGMDFSQAMTRWVLQPLGLKHTYFRVPPAAEGEYAWGYREGKALRVSPGM
LEQEAYGIKSSAQDMATWLQANLDPAAVPQATLRQALLRAQTRYYQSGEMYQGLGWEMLS
WPLQAQTLIDGSDNRVALQPQPVHLIEPPTPPQPASWVHKTGSTNGFGAYIAFIPGSRLG
IVMLANKNYPNPARVQAAYTILQQLQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacacgcgattatcctgcacgctggcgctctccgcgctgctgctctcctcgggc
gcccaggcgtctacgccgccgtcggcagagatgcgggtcgccgaggcggtgaaacagacg
atccctgcgctgatgcagcagcagcagatccccggcatggccgtggccgtaatctatcag
ggaaccccttactacttcaactatggcgtcgccgataaggccacccggcgggcagtgacg
ccacaaacgctgtttgagctggggtccgtgagcaagacctttaccggcgtgctgggtggc
tatgcgctgcagcgtggcgatattcgcctgcaggacacggtcgcgtcccaatggccggcg
ttaaatggaccgcagtggcgggcgataaccctacagcagctggcgacctacaccgcgggc
ggcctgccgctgcaggtgcccgacgccgttaccgatacggcacagctgctcgacttttat
caacgctggcagccgcgctgggctccgggaacgatgcgcagctactccaacgccagtatt
ggcctttttggcatgctggcggtacggcccagcggcatggattttagccaggcgatgaca
cgctgggtgctgcagccgctgggattgaagcatacctatttccgcgtaccgcctgccgcg
gagggagaatatgcctggggataccgcgagggtaaggccctgcgcgtgagcccgggtatg
ctggagcaggaggcctatggaattaaatccagcgcgcaggatatggccacctggctacag
gctaatctggatcccgccgcggtgccacaggcgacgctgcgtcaggccttgctgcgggcg
cagacgcgctactaccaatccggtgagatgtatcaagggctcggctgggagatgctcagc
tggcctctgcaggcgcagaccttgatagacggtagcgataatcgggtcgctctgcagccg
cagccagtccatctcatcgagccgccgacgccgccgcagccggcttcctgggtacataag
accggttcaaccaatggatttggcgcctatattgcctttattcccggatctcggctgggg
atcgtgatgttggccaataaaaactacccgaacccggcgcgggttcaggccgcctatacc
atcctgcagcagctgcagtaa

DBGET integrated database retrieval system