KEGG   Edwardsiella piscicida C07-087: ETAC_15380Help
Entry
ETAC_15380        CDS       T02509                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:etc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    ETAC_15380 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:etc03011]
    ETAC_15380 (rplV)
Ribosome [BR:etc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    ETAC_15380 (rplV)
  Bacteria
    ETAC_15380 (rplV)
  Archaea
    ETAC_15380 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGH75197
Position
complement(3480031..3480363)
Genome map
AA seq 110 aa AA seqDB search
METIAKHCHARSSAQKVRLVADLIRGKKVSQALEVLTYTNKKAAVLVKKVLESAIANAEH
NDGADIDDLKVSKIFVDEGPTMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactattgctaagcattgccatgctcgctcttctgctcagaaggttcgcctggtg
gctgacctgatccgcggtaagaaagtgtcacaggctctggaagttctgacctacaccaac
aagaaagcggctgtactggtcaaaaaggttctggaatctgccattgctaacgcagaacac
aacgatggcgctgacatcgatgatctgaaagtatccaagatcttcgtcgacgaaggcccg
accatgaagcgcatcatgccgcgtgcaaaaggtcgcgctgatcgtatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system