KEGG   Edwardsiella piscicida C07-087: ETAC_15490Help
Entry
ETAC_15490        CDS       T02509                                 

Gene name
argD
Definition
(GenBank) bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00220  Arginine biosynthesis
etc00300  Lysine biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
etc_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    ETAC_15490 (argD)
   00220 Arginine biosynthesis
    ETAC_15490 (argD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:etc01007]
    ETAC_15490 (argD)
Enzymes [BR:etc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     ETAC_15490 (argD)
    2.6.1.17  succinyldiaminopimelate transaminase
     ETAC_15490 (argD)
Amino acid related enzymes [BR:etc01007]
 Aminotransferase (transaminase)
  Class III
   ETAC_15490 (argD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGH75219
Position
complement(3497085..3498299)
Genome map
AA seq 404 aa AA seqDB search
MTQKNTVERGNFEKVMLPVYAPAEFVPVRGQGSRVWDQQGRDYIDFAGGIAVTALGHCHP
ALVAALQEQGSRLWHTSNVFTNEPALRLAQKLIDATFAERVFFANSGAEANEAALKLARY
HAATRISPHKSQIIAFKQGFHGRTLFTVSVGGQAKYSDGFGPKPADIVHVPFNDVTAVEA
IIGEQTCAVIVEPVQGEGGVLPASAAFLQGLRTLCDRHQALLIFDEVQSGMGRSGRLFSY
MHYGVTPDILTSAKALGGGFPISAMLTTDAIASAMTVGCHGTTYGGNPLACAVAEAAFDI
ISQPQVLAGVATRRQAIVSHLQALNQRHGVFSEIRGQGLLLGAALSPAYRGRARDILHAA
AEQGVMLLNAGADTLRFTPSLVIETVEIDEGMARLGRALDTLAA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagaaaaacacagtggagaggggcaattttgaaaaggtgatgttgccggtttat
gcacctgcagagtttgtgccggtgcgcggtcaaggcagccgagtgtgggatcagcaggga
cgtgactatatcgactttgccggcggcattgcggtgacggcgctggggcattgccatccg
gcattggtggctgcgctacaggagcaggggagccgcctatggcataccagcaatgtcttc
accaatgagcccgcgctgcgtctggcgcaaaagctgatcgatgccacctttgccgagcgg
gtgttttttgctaactccggcgcagaggccaatgaggcggcgctaaagctggcccgctac
catgccgcgacgcgcatcagcccccataaaagccagattatcgcctttaagcaggggttt
cacggtcgcacgctgtttacggtatcggttggggggcaggcgaagtattcggacggcttt
gggccaaagccggcggatattgtgcacgtcccgtttaacgacgtgacggcggttgaggcg
atcatcggtgaacagacctgcgcggtgatcgtcgagccggtacagggcgagggcggggta
ttgccggccagcgccgcgtttctgcaggggctgcgaacgctgtgcgatcgccatcaggcg
ctgctgatttttgatgaggtgcaaagcggaatggggcgcagcggcaggctgtttagctat
atgcactacggcgtgacgccggacattctgaccagcgctaaggcgctgggcggcgggttt
ccgatcagcgccatgctgaccaccgacgcgatcgcctctgcgatgacggtgggctgccac
ggcacgacctacggcggcaatccactggcctgcgcggtggcggaggcggcgttcgatatc
attagtcagccgcaggtcctcgccggggtagcgacgcgccgacaggccatcgtcagccat
ttgcaggcgcttaaccagcgccacggtgtgtttagcgaaatccgcggacaggggctactg
ctgggggctgccttatcgcccgcctaccgggggcgggctcgagacattctgcatgcggcg
gcggagcagggcgtgatgctgctgaacgccggcgccgatacgctgcgctttacgccgtct
ctggtgatcgagacggtggaaatcgacgagggcatggcccgcctggggcgggcgctggat
acgctggcggcctag

DBGET integrated database retrieval system