KEGG   Edwardsiella piscicida C07-087: ETAC_15535Help
Entry
ETAC_15535        CDS       T02509                                 

Definition
(GenBank) Ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00030  Pentose phosphate pathway
etc00040  Pentose and glucuronate interconversions
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
etc_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ETAC_15535
   00040 Pentose and glucuronate interconversions
    ETAC_15535
Enzymes [BR:etc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     ETAC_15535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribul_P_3_epim QRPTase_C FMN_dh
Motif
Other DBs
NCBI-ProteinID: AGH75228
Position
complement(3507380..3508057)
Genome map
AA seq 225 aa AA seqDB search
MNPYLIAPSILSADFARLGEDTAKVLAAGADVVHFDVMDNHYVPNLTIGPMVCKALRDYG
ITAPIDVHLMVKPVDRIIPDFADAGASIITFHPEASEHVDRTLQLIRACGCKAGLVLNPA
TPLSCLDYVMDRLDTILLMSVNPGFGGQSFIPSTLDKLRQVRQRIDASGLDIRLEVDGGV
KVDNIGAIAAAGADMFVAGSAIFGHADYAAVITDMRREIAQACHE
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtatttaattgccccgtcgattttgtccgcagactttgcccggctgggcgaa
gatactgccaaggtgttggccgccggtgccgatgtggtgcactttgatgtcatggataac
cactatgtgccgaatttgaccatcggtccgatggtctgcaaggcgctgcgggactatggc
atcaccgccccgatcgatgttcacctgatggtgaaaccggtcgatcggatcatcccggat
ttcgccgacgccggcgccagcattattaccttccatccggaggcctcggagcacgtcgat
cgcactctgcagctgatccgcgcctgtggctgtaaggcggggctggttctgaacccggca
acgccgctgagctgcctggattacgtgatggatcgcctcgataccatcctgctgatgtcc
gtaaacccgggctttggtggtcagtcctttatcccgtcgaccctcgataagctgcgtcag
gtgcgtcagcgcattgatgccagcggtctggatattcgcctggaggttgacggcggcgtg
aaggtggacaacatcggcgctatcgccgcggccggcgccgatatgtttgttgccggctcg
gccattttcggccacgctgactatgcggcggtgatcacggatatgcggcgtgaaattgcg
caggcctgccatgaataa

DBGET integrated database retrieval system