KEGG   Edwardsiella piscicida C07-087: ETAC_15635Help
Entry
ETAC_15635        CDS       T02509                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00020  Citrate cycle (TCA cycle)
etc00620  Pyruvate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_15635
   00020 Citrate cycle (TCA cycle)
    ETAC_15635
   00620 Pyruvate metabolism
    ETAC_15635
Enzymes [BR:etc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     ETAC_15635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AGH75248
Position
3527880..3529499
Genome map
AA seq 539 aa AA seqDB search
MHAKGLTAADLASYGISDVTEIVHNPDYDLLFKEETAPGLQGYERGTVTSLGAVAVDTGI
FTGRSPKDKYLVRDTTTRDTVWWSDQGKGKNDNHPLSPEVWQHLKGLVTRQLSNKRLFVV
DAYCGANPDSRLKVRFITEVAWQAHFVKNMFIRPEADELAGFEPDFIVMNGAKCTNPQWQ
AQGLNSENFVAFNLTERIQLIGGTWYGGEMKKGMFSIMNYLLPLKGIASMHCSANVGEQG
DVAIFFGLSGTGKTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIKLSADAEPDIY
GAITRDALLENVTVRADGSVDFDDGSKTENTRVSYPIYHIKNIVKPVSKAGAAKKVIFLT
ADAFGVLPPVSRLTADQTQYHFLSGFTAKLAGTERGVTEPTPTFSACFGAAFLTLHPTQY
AEVLVKRMQAAGAQAYLVNTGWNGSGKRISIQDTRAIIDAILNGDIDRVETFTLPIFNLA
VPTELPGVNPAILDPRDTYANREQWQEKAQDLAQRFITNFDKYTDTPAGAALVHAGPQR
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcatgccaaaggcttaaccgcagctgatctcgcctcctacggcatttctgacgttact
gaaatcgtccataatcccgattacgacctcttattcaaggaagaaaccgccccgggccta
cagggctatgagcgcggtaccgttacctctctgggcgccgttgccgtggataccggtatt
tttaccggccgttcccccaaggataagtacctggtgcgcgacaccaccacccgcgatacc
gtctggtggtccgatcagggcaagggcaagaatgacaaccacccgctgtcgccggaagtc
tggcagcatctgaaggggctggtgacccgccagctctccaacaagcgcctgttcgtcgtc
gatgcctactgcggcgccaacccggacagccgcctgaaggttcgctttattaccgaggtg
gcctggcaggcccacttcgtcaaaaatatgttcatccgtccagaggcggatgaactggcc
ggttttgaacccgatttcatcgtgatgaacggagccaaatgcaccaacccgcagtggcag
gcacaggggctgaactccgaaaactttgtcgcctttaacctgaccgaacgcattcagctg
atcgggggaacctggtacggcggcgagatgaagaaggggatgttctccatcatgaactac
ctgctgccgttaaaaggcatcgcctccatgcactgctccgccaacgtgggcgaacagggc
gacgtggcgatcttctttggcctctccggcaccgggaaaaccacgctctcgaccgatccg
aagcgccgtctgatcggcgatgacgagcacggttgggacgatgacggcgtgtttaacttt
gagggcggctgctacgcgaagaccattaaactctccgccgacgccgaacccgacatctac
ggcgccatcacccgcgatgcgctgctggaaaacgtcacggtgcgggcggatggcagcgtc
gactttgatgacggcagcaagaccgaaaacacccgcgtctcctaccccatctaccacatt
aagaatattgtgaagccggtctctaaggccggggcggccaagaaggtcattttccttacc
gccgacgccttcggcgtcctgccgccggtctcccgcctgaccgcggatcagacgcagtat
cacttcctgtccggcttcacggccaagctggccggtaccgaacgcggcgtgaccgaaccg
acgccaaccttctccgcctgcttcggcgccgcattcctgacgctgcaccccacccaatac
gccgaggtgctggtcaagcggatgcaggcggccggcgctcaggcctacctggtcaatacc
ggctggaacggcagcggcaagcggatctccattcaggatacccgcgccattatcgatgcc
atcctcaacggcgatatcgatcgggtggaaacctttaccctgccgatctttaacctggcg
gtgccgaccgagctgcccggcgtcaatccggcgatcctcgatccgcgcgatacctacgcc
aaccgcgagcagtggcaagagaaggcccaggatctggcgcagcgtttcatcaccaacttc
gataagtacaccgatacgcccgcgggcgccgcgctggttcacgccggccctcagcgctaa

DBGET integrated database retrieval system