KEGG   Edwardsiella piscicida C07-087: ETAC_15640Help
Entry
ETAC_15640        CDS       T02509                                 

Gene name
envZ
Definition
(GenBank) osmolarity sensor protein
  KO
K07638  two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00445  EnvZ-OmpR (osmotic stress response) two-component regulatory system
etc_M00742  Aminoglycoside resistance, protease FtsH
etc_M00743  Aminoglycoside resistance, protease HtpX
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_15640 (envZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_15640 (envZ)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_15640 (envZ)
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_15640 (envZ)
Protein kinases [BR:etc01001]
 Histidine kinases
  OmpR family
   ETAC_15640 (envZ)
Two-component system [BR:etc02022]
 OmpR family
  EnvZ-OmpR (osmolarity) [MD:M00445]
   ETAC_15640 (envZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: AGH75249
Position
complement(3529603..3530988)
Genome map
AA seq 461 aa AA seqDB search
MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
KLQLEDGTQLEVPPAFRREIYRELGISLYTNSAAEENGLRWAQHYQFLSQQMAQQLGGPT
DVRVEISKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
IQNRPLVELEHAALQVGKGQIPPPLREYGASEVRSVTRAFNQMAAGVKQLADDRTLLMAG
VSHDLRTPLTRIRLATEMMSPQDAYLAESINKDTEECNAIIEQFIDYLRTGQEMQTEACD
LNGILTEVVAAESGYEREIDTDLADGELLIDAHPLSIKRAVVNMVVNATRYGNGWIKVSS
GMEGARAWFQVEDDGPGIDDAHLAHLFQPFVRGESARTTSGTGLGLAIIQRIIDAHHGSL
DIGRSERGGLKIRAYLRRVNMIAANAPDTVPRSGGRRKERV
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagacgactgcgtttctcgccgcgcagctcttttgcccgcaccctgttgctgatcgtc
accctgctgttcgtcagcctggtgacgacctacttggtcgtgttgaactttgccattctg
cccagtttgcaacagttcaataaggtgctggcctatgaggtgcggatgctgatgacggat
aagctgcagctggaggatggtacccagctggaggttccgccggcgtttcgccgcgagatt
taccgcgagcttggcatttcgctgtacaccaattcagcggcggaagagaacgggctgcgc
tgggcgcaacattaccagttccttagccagcagatggcgcagcagctgggcggcccgacg
gacgtgcgggttgaaatcagcaagaatacgccggtggtctggctcaagacctggctatcg
cctgatatctgggtgcgggtgccgttgacggagatccatcagggcgatttttcacctctg
ttccgctacacgctggcgattatgctgctggcgatcggcggagcctggctgtttattcgg
atacaaaatcgaccgttggtcgagctggagcatgccgccctgcaggttggtaaggggcag
attccgccgccgctgcgtgagtatggcgcctcggaggtgcgctcggtgacccgggcgttt
aatcagatggcggcgggggttaaacagctggccgacgatcgcaccctgctgatggccggg
gtcagccacgatctgcgtaccccgctgacgcgtattcgtctggcgacggagatgatgagt
ccgcaggatgcctatctggcggagtcgatcaacaaggatacggaagagtgtaacgccatt
attgagcagtttatcgactatctgcgcaccggtcaggagatgcagaccgaggcgtgcgat
ctgaacggcattctgaccgaggtcgtggcggcggagagcggctatgagcgtgagatcgat
accgatctggccgacggcgagctgttgatcgacgcgcatccgctgtcgattaagcgggcc
gtcgtcaatatggtggtcaacgcgacccgctacggtaatggctggatcaaggtcagcagc
ggtatggagggtgcgcgtgcctggttccaggtggaggatgacggccctgggatcgacgat
gcgcatctggctcatctgttccagccctttgtccgcggtgaaagtgcgagaaccaccagc
ggaaccggcctggggctggcgatcattcagcgtattatcgatgctcatcacggttcgctg
gatattggtcgcagcgagcgcggtggactgaagatccgagcctatttacgacgggtcaat
atgatcgcggccaatgcgcccgataccgtgccgcgcagcggcgggcgtcgtaaagagcgc
gtctga

DBGET integrated database retrieval system