KEGG   Edwardsiella piscicida C07-087: ETAC_15645Help
Entry
ETAC_15645        CDS       T02509                                 

Gene name
ompR
Definition
(GenBank) osmolarity response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00445  EnvZ-OmpR (osmotic stress response) two-component regulatory system
etc_M00742  Aminoglycoside resistance, protease FtsH
etc_M00743  Aminoglycoside resistance, protease HtpX
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_15645 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_15645 (ompR)
Two-component system [BR:etc02022]
 OmpR family
  EnvZ-OmpR (osmolarity) [MD:M00445]
   ETAC_15645 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AGH75250
Position
complement(3530985..3531704)
Genome map
AA seq 239 aa AA seqDB search
MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPG
EDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
RRQANELPGAPSQEDAVINFGKFKLNLGTREMFRDDEPMPLTSGEFAVLKALVSHPREPL
SRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaattacaaaattctcgttgttgatgatgatatgcgcctacgggctctgctg
gagcgctatctgactgaacagggattccaggtgcgcagcgttgctaacgcagagcagatg
gatcgcctgctgacgcgtgaatctttccacctgatggtgctggatctgatgctgccgggc
gaagatggcctgtctatctgccgccgcctgcgcagccagagcaacccgatgccgatcatt
atggtgacggccaaaggggaggaggtggatcgcatcgtggggctggaaattggcgcagat
gactatattcccaagccgtttaacccgcgtgagctgctggcgcgtatccgcgcggtgctg
cgccgtcaggccaacgaactgcccggagctccgtcccaagaggacgccgtgattaacttt
ggtaagttcaagctcaatctgggcacgcgcgaaatgttccgtgacgatgagccgatgccg
ttgaccagcggcgagtttgccgtgctcaaggcgctggtgagccatccgcgtgagccgctg
tcgcgcgataagctgatgaatctggcgcgcgggcgcgagtacagcgccatggagcgctcc
atcgacgtgcagatctcccgtctgcgtcgaatggtagaagaggacccggcgcatccgcgc
tacattcagaccgtatggggtctggggtatgtctttgtcccggacggcagtaaagcatga

DBGET integrated database retrieval system