KEGG   Edwardsiella piscicida C07-087: ETAC_15675Help
Entry
ETAC_15675        CDS       T02509                                 

Definition
(GenBank) Biotin synthesis protein BioH
  KO
K02170  pimeloyl-[acyl-carrier protein] methyl ester esterase [EC:3.1.1.85]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00780  Biotin metabolism
etc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ETAC_15675
Enzymes [BR:etc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.85  pimelyl-[acyl-carrier protein] methyl ester esterase
     ETAC_15675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase Abhydrolase_5 Esterase PGAP1
Motif
Other DBs
NCBI-ProteinID: AGH75256
Position
complement(3538599..3539375)
Genome map
AA seq 258 aa AA seqDB search
MSALFWHTCGAGKRDLVLLHGWGLNAEVWRCIVPLLSAQFRLHLVDLPGYGRSGGDTPYS
LAEMTQRALAQAPARALWLGWSLGGLVATQAALHHPQRVSGLITVASSPCFTAQTAWPGI
RGDVLHHFQSQLRDDFQRTVERFLALQTLGTDSARQDARALKSVVLAQPMPSAAVLNGGL
SLLRETDLRSQLATLAPPWLRLYGALDGLVPRRVAPLVDALSPRGRSLIIPGAAHAPFIS
HPAPFCAALCDFAGEASA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgctgttttggcatacctgcggcgcgggtaaacgcgatcttgtgctgctgcac
ggctgggggctgaatgccgaagtgtggcgttgcattgttcccctgctctccgcgcagttt
cgcctgcacctggtcgatctgcccggctatgggcgtagcggcggcgatacgccctattcg
ctggcggagatgacgcagcgggcgctggcgcaggcgccggcgcgggcgctatggctgggc
tggtcgctggggggactcgtcgccacccaggcggccctgcatcacccgcagcgggtcagc
ggcttaatcaccgtcgcctcctcgccctgtttcacggcacagacggcgtggccggggatc
cgcggcgatgtgctgcaccattttcaatcacagctgcgcgatgattttcagcgtacggtg
gagcgttttctggcgctgcagacgctggggaccgacagcgcccggcaggatgcccgcgcg
ctgaagtcggtggtgctggcgcagccgatgccgtcggcggcggtcttgaacggggggctg
tccctgctgcgcgaaaccgatctgcgctcgcagctggcgacgctggcgccgccgtggctg
cgcctctatggtgcgctggacggtctggttccgcgccgagtggcgccgctggtggatgcg
ctcagcccgcgcggccgctcgctgattattcccggcgccgcccacgccccctttatctcc
caccctgcgcccttttgcgccgcgctgtgcgattttgccggcgaggcgtcggcataa

DBGET integrated database retrieval system