KEGG   Edwardsiella piscicida C07-087: ETAC_15695Help
Entry
ETAC_15695        CDS       T02509                                 

Definition
(GenBank) L-ascorbate 6-phosphate lactonase
  KO
K03476  L-ascorbate 6-phosphate lactonase [EC:3.1.1.-]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00053  Ascorbate and aldarate metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
Module
etc_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    ETAC_15695
Enzymes [BR:etc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     ETAC_15695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B_3 Lactamase_B_2 Lactamase_B
Motif
Other DBs
NCBI-ProteinID: AGH75260
Position
complement(3541669..3542733)
Genome map
AA seq 354 aa AA seqDB search
MSKLDDITRESWILNTFPEWGTWLNEEIEQATVDPGSFAMWWLGCTGIWLKSEGGTNLCI
DFWCGTGKRSHANPWMATGHQMQRMAGVQKLQPNLRTSPFVLDPFAIREIDAVLATHDHN
DHIDINVAAAVLRNAAPDVPFIGPQRCVDLWVSWGVPRDRCRVVVPGDTIRIKDTEIVAL
DAFDRTALITLPPSERAQGTLPDGMDLRAVNYLFKTPAGSLYHSGDSHYSNYYAKHGNDH
RIDVALGSYGENPRGITDKMTSADILRMAEALKAKVVIPFHHDIWSNFQADPQEIRVLWQ
MKKDRLGYDFTPFIWQVGGKFTWPQDQGRLEYHYPRGFDDCFTQEPDLPFKAFL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacttgatgacattacccgcgagtcctggatcctgaacacgtttccggagtgg
gggacctggctgaacgaggagatagagcaggcgacggtggatcccggtagctttgcgatg
tggtggctgggctgtaccgggatctggctgaagtcggagggggggacgaatctgtgcatc
gatttttggtgcggaaccggtaagcgcagccatgccaatccgtggatggcgacggggcac
cagatgcagcggatggccggggtgcagaagctgcagcccaatctgcgcacctcgcccttt
gtgctcgatccttttgccatccgcgagatcgatgcggtgctggcgacccacgaccataat
gatcatatcgatatcaatgtggcggccgcggtgctgcgcaatgcggcaccggacgtcccc
ttcatcggcccgcagcgctgcgtcgatctgtgggtatcgtggggtgtgccgcgcgatcgc
tgccgggtggtggtccccggcgatacgatccggatcaaagatacggagatcgtggcgctg
gacgccttcgatcgcaccgcgctgatcacgctgccgccgtcggagcgggcgcagggtacg
ctgcccgacggtatggatctgcgggcggttaactacctgtttaagacgcccgcgggttcg
ctgtaccacagcggcgactcccactactccaactattacgccaagcacggcaacgatcat
cgcatcgacgtggcgctcggctcctatggcgagaatccgcgcgggatcaccgacaagatg
accagcgccgatatcctgcggatggccgaggcgctgaaggccaaagtggtgatcccgttt
catcatgatatctggtctaacttccaggccgatccgcaggagatccgggtgctgtggcag
atgaagaaagatcgtctgggctacgacttcaccccctttatctggcaggtgggcggtaag
tttacctggccacaggatcaggggcggctggagtatcactacccgcgcggctttgacgac
tgcttcacccaggagccagacctgccctttaaggcctttttgtag

DBGET integrated database retrieval system