KEGG   Edwardsiella piscicida C07-087: ETAC_15720Help
Entry
ETAC_15720        CDS       T02509                                 

Definition
(GenBank) L-xylulose 5-phosphate 3-epimerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00040  Pentose and glucuronate interconversions
etc00053  Ascorbate and aldarate metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
Module
etc_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ETAC_15720
   00053 Ascorbate and aldarate metabolism
    ETAC_15720
Enzymes [BR:etc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     ETAC_15720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 AP_endonuc_2_N
Motif
Other DBs
NCBI-ProteinID: AGH75265
Position
3545992..3546864
Genome map
AA seq 290 aa AA seqDB search
MLHSTVPLGIYEKALPAGEDWPRRLAQAAQLGFDFVEMSIDESDRRLARLTWSRQQRLDL
LAAMAHSGVRIPSLCLSAHRRFPLGSEDPAVRRQALRLLAHAITLAQDLGIRVIQLAGYD
VYYQQGNALTRRLFREGLSQAVTMASRAQVTLAMETMDTPLLNSVSKALGYCRYLRSPWF
QVYPDIGNLSAWDNDVELELVAGIDRIVAVHVKDTRPGQFRDVPFGSGVVDFETCFRTLD
RHGYRGPYLIEMWSESAPDPLQAVREAREWIIERMRRAGLAVTQEASWNG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgctgcattccacggtgccgctgggcatctatgaaaaggcgctgcccgccggcgaagac
tggccacgacgcctggcgcaggccgcgcagctcgggttcgacttcgtcgaaatgtctatc
gatgaaagcgatcgccgcctggcccgactgacctggtcgcgccagcagcgtctggatctg
ctggcggcaatggcgcacagcggcgtacgtattccctccctgtgcctcagcgcccaccgc
cggtttccgctgggcagcgaggatccggcggtcaggcgtcaggcgctgcggctgctggcc
cacgcgattaccctcgcccaggatctgggtatccgggttattcagctggcgggatacgac
gtctactatcagcagggcaatgccctgacccgccgactgttccgcgaggggctgagccaa
gccgtcaccatggccagccgggcgcaggtcacgctggccatggagaccatggacacgccg
ctgctcaactccgttagcaaagcgctcggctactgccgctatctgcgcagcccctggttc
caggtctacccggatatcggcaacctttcggcctgggataatgacgtcgagctggagctg
gtggccggcatcgaccgcatcgtcgccgtgcatgtcaaagatacccggccgggccagttt
cgggatgtgcctttcggcagcggtgtggtcgactttgagacctgcttccgcacgctggat
cgccatggctaccgcggtccctacctgatcgagatgtggagcgaaagcgccccggacccg
ctgcaggcggtgcgcgaggcgcgtgagtggatcattgaacggatgcgacgcgccggactg
gcggtgacgcaggaggcctcatggaacggctga

DBGET integrated database retrieval system